Recombinant Mouse Transmembrane protein 192 (Tmem192)

Shipped with Ice Packs
In Stock

Description

Species-Specific Features

  • Mouse vs. Human: Murine TMEM192 shares lysosomal localization and dimerization properties with its human orthologue but differs in proteolytic processing patterns .

Expression and Localization

TMEM192 exhibits distinct expression profiles across tissues and cell types:

Tissue Distribution (Mouse)

TissueExpression LevelNotes
BrainHighHippocampus > Cortex ≈ Cerebellum
LiverModerateNo 17 kDa fragment detected
KidneyHighAbundant mRNA and protein
Spleen/IntestineLow/UndetectableMinimal mRNA expression

Cell Line Expression

  • Tumor vs. Normal: Elevated in hepatoma (HepG2), neuroblastoma (SK-N-SH), and other cancer cells compared to normal lines (e.g., LO2 hepatocytes) .

  • Subcellular Localization: Co-localizes with lysosomal markers (LAMP1, LysoTracker) and late endosomal compartments .

HepG2 Hepatoma Cell Studies

  • TMEM192 Knockdown (siRNA):

    • Autophagy Activation: Increased LC3-II (autophagy marker) and ER stress (caspase-12 cleavage) .

    • Apoptosis Induction: Upregulation of Bax, caspase-3 activation, and p38 MAPK phosphorylation .

    • Growth Inhibition: Reduced proliferation linked to autophagy-apoptosis crosstalk .

TMEM192 Knockout Mice

  • Phenotype: No overt lysosomal storage defects or developmental abnormalities under basal conditions .

  • Compensatory Mechanisms: Normal lysosomal exocytosis and autophagy flux observed in embryonic fibroblasts (MEFs) .

Key Research Tools

  • Antibodies: Anti-TMEM192 antibodies (e.g., Boster Bio A11938) validated for Western blot, immunohistochemistry, and immunofluorescence .

  • siRNA Models: Used to study TMEM192's role in tumor cell survival and stress responses .

Disease Relevance

  • Cancer: High TMEM192 expression in tumors suggests a potential role in cancer cell adaptation to stress .

  • Neurological Disorders: Hippocampal enrichment hints at unexplored roles in brain function or pathology .

Unresolved Questions and Future Directions

  • Molecular Mechanism: The exact function of TMEM192 in lysosomal signaling remains unknown .

  • Therapeutic Potential: Targeting TMEM192 in cancers with dysregulated autophagy warrants exploration .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have specific format requirements, please indicate them during order placement. We will fulfill your request accordingly.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery times.
Note: All proteins are shipped with standard blue ice packs by default. If dry ice shipping is required, please contact us in advance. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors such as storage conditions, buffer composition, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us. We will prioritize developing the specified tag.
Synonyms
Tmem192; Transmembrane protein 192
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-266
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Tmem192
Target Protein Sequence
MAAAGRLEDSSLDILQSMDDDPLLDTQPLPHHSLQAQFRPRFHPLPTVIIANLLLLIHVV FVVLAFLTGVPCLYPNPTEDKCPENYTSPLKVQTAIILGKLILWILHLLFERYVQYHHRK VRSRGYSQIYRSTRHLKTLALTIHSSGNTALLLLLCVQHSFPEPSKLYLELILAVLALEL ICSLSCLILYIVKIRRFNRAKPLPDVLEEEKIYAYPSNTASETGFRTVSSLEEIVEKQED IIVYLKRHNALLSKRLLELATQPART
Uniprot No.

Target Background

Database Links
Protein Families
TMEM192 family
Subcellular Location
Lysosome membrane; Multi-pass membrane protein. Late endosome.

Q&A

What is Transmembrane protein 192 (Tmem192) and where is it localized in cells?

Transmembrane protein 192 (TMEM192) belongs to the TMEM192 protein family and has been identified through proteomic analyses of lysosomal membranes. Multiple experimental approaches have confirmed that TMEM192 is predominantly localized in membranes of lysosomes and late endosomes. This localization has been validated through studies using epitope-tagged fusion proteins in HeLa cells and TMEM192-specific antibodies for detection of endogenous protein . Additionally, co-sedimentation experiments using Percoll density gradient centrifugation have demonstrated that TMEM192 co-sediments with established lysosomal proteins like LAMP-2 and cathepsin D in high-density fractions, providing biochemical confirmation of its lysosomal residence .

Methodological approach: To confirm TMEM192 localization in your experimental system, perform immunofluorescence co-localization studies with established lysosomal markers (LAMP1, LAMP2) and late endosomal markers (Rab7, Rab9). Subcellular fractionation followed by western blotting can provide complementary biochemical evidence of localization.

How is TMEM192 structurally characterized?

TMEM192 is a multi-pass membrane protein with four potential transmembrane segments with both N-terminus and C-terminus oriented toward the cytosolic side . A distinctive structural feature of TMEM192 is its ability to form homodimers stabilized by one or more interchain disulfide bridges. This dimerization has been demonstrated through western blotting of reduced and non-reduced samples and co-immunoprecipitation experiments .

Two dileucine motifs present at the amino-terminus mediate TMEM192's localization to late endosomal/lysosomal membranes, while a cysteine residue near the C-terminus is responsible for the formation of disulfide bonds that facilitate dimerization . Interestingly, unlike many other lysosomal proteins, TMEM192 does not undergo N-glycosylation .

What is the tissue distribution pattern of TMEM192?

TMEM192 exhibits a widespread tissue distribution pattern, suggesting an important role in fundamental lysosomal functions. In humans, TMEM192 is strongly expressed in kidney, liver, lung, and pancreas tissues . In brain tissue, TMEM192 expression is particularly pronounced in the hippocampus, but it is also present in the cortex and cerebellum, as determined through analyses based on a lacZ reporter allele .

In mice, TMEM192 shows a similarly ubiquitous expression pattern but undergoes tissue-specific proteolytic processing. The protein generates a 17 kDa fragment that has been detected in most murine tissues except the liver, indicating potential tissue-specific regulatory mechanisms .

What are the known functions of TMEM192?

Despite extensive characterization, the precise molecular function of TMEM192 remains incompletely understood. Studies have suggested several potential roles:

  • Lysosomal function: Its widespread expression and lysosomal localization suggest involvement in fundamental lysosomal processes .

  • Autophagy regulation: Knockdown of TMEM192 in hepatoma cells has been reported to cause dysregulation of autophagy, suggesting a role in this cellular process .

  • Cell survival: Increased apoptosis has been observed upon TMEM192 knockdown in hepatoma cells, indicating a potential role in cell survival pathways .

Interestingly, TMEM192 knockout mice showed normal lysosomal functions without apparent lysosomal storage disorders, and TMEM192-deficient murine embryonic fibroblasts exhibited regular morphology of endo-/lysosomes with normal capacity for autophagy and lysosomal exocytosis . These seemingly contradictory findings highlight the complexity of TMEM192's role and suggest possible compensatory mechanisms in knockout models or cell-type specific functions.

How can TMEM192 be used as a tool to study lysophagy?

TMEM192 has been engineered into a specialized probe for studying lysophagy, a type of selective autophagy that targets damaged lysosomes for degradation. The TMEM192-mKeima probe has been developed to evaluate lysophagy with greater specificity than conventional assays like galectin-3 .

Methodological implementation:

  • Express the TMEM192-mKeima construct in cells of interest using appropriate transfection or transduction methods.

  • Induce lysosomal damage using established methods (e.g., LLOMe treatment, silica crystals).

  • Monitor changes in fluorescence properties of mKeima, which changes its excitation spectrum in acidic environments.

  • Compare results with conventional lysophagy markers like galectin-3.

This approach has already yielded significant insights, including:

  • TFEB and p62, previously thought to be involved in lysophagy, are actually important for the lysosomal damage response but not specifically for lysophagy itself .

  • UBE2L3, UBE2N, and TRIM10, 16, and 27 have been identified as factors involved in the initial steps of the lysophagy process .

What methods are available for detecting TMEM192 in cellular and tissue samples?

Several validated approaches exist for detecting TMEM192 in experimental settings:

MethodApplicationNotes
Western blottingProtein expression analysisTMEM192 typically appears at ~68 kDa (observed) vs. calculated ~31 kDa. Compare reduced/non-reduced conditions to assess dimerization
Immunohistochemistry (IHC-P)Tissue localizationEffective for paraffin-embedded tissue sections
Immunofluorescence (IF)Subcellular localizationCo-stain with lysosomal markers for confirmation
ELISAQuantitative assessmentAllows for measurement of TMEM192 levels in solution
Percoll density gradientSubcellular fractionationDemonstrates co-sedimentation with lysosomal proteins

For optimal detection of endogenous TMEM192, validated antibodies are available that recognize human, mouse, and rat TMEM192 . When using epitope-tagged constructs, ensure the tag doesn't interfere with trafficking signals at the N-terminus or dimerization motifs near the C-terminus.

What is the significance of TMEM192 dimerization and how can it be studied?

TMEM192 forms homodimers with one or more interchain disulfide bridges, a characteristic that may be crucial for its function within lysosomal membranes . A cysteine residue near the C-terminus has been identified as responsible for the formation of these disulfide bonds .

To study TMEM192 dimerization, implement these approaches:

  • Comparison of reduced vs. non-reduced western blotting: Under non-reducing conditions, dimeric TMEM192 appears at a higher molecular weight compared to the monomeric form seen under reducing conditions .

  • Co-immunoprecipitation with differentially tagged versions: Co-express FLAG-TMEM192 and HA-TMEM192, then immunoprecipitate with one tag and detect with the other.

  • Site-directed mutagenesis: Mutate the critical cysteine residue(s) involved in disulfide bond formation, followed by functional analyses to determine the importance of dimerization for protein localization and function.

  • Crosslinking experiments: Use chemical crosslinkers to stabilize protein-protein interactions before cell lysis and analysis.

Understanding TMEM192 dimerization could provide insights into its functional mechanisms and potentially reveal new therapeutic targets for lysosomal disorders.

How does proteolytic processing of TMEM192 differ across tissues and what might be its functional significance?

Murine TMEM192 undergoes tissue-specific proteolytic processing, generating a 17 kDa fragment detected in most murine tissues except the liver . This processing occurs after lysosomal targeting by pH-dependent lysosomal proteases.

Methodological approaches to study this processing:

  • Tissue-specific western blotting using antibodies that can detect both full-length protein and processed fragments.

  • Protease inhibitor studies to identify specific proteases responsible for TMEM192 processing.

  • Pulse-chase experiments with metabolic labeling to track processing kinetics.

  • Site-directed mutagenesis of potential cleavage sites to determine the exact location of processing.

The functional significance of this proteolytic processing remains to be fully elucidated, but it may potentially regulate TMEM192's interactions, stability, or specific functions. The absence of processing in liver tissue is particularly intriguing and may reflect tissue-specific regulatory mechanisms.

What phenotypic changes occur in TMEM192 knockout models and how can they be assessed?

Studies of TMEM192 knockout mice have yielded somewhat surprising results, showing normal lysosomal functions without apparent lysosomal storage disorders . TMEM192-deficient murine embryonic fibroblasts exhibited regular morphology of endo-/lysosomes with normal capacity for autophagy and lysosomal exocytosis.

Comprehensive phenotypic assessment should include:

Assessment MethodParametersAdvantages
Histopathological analysisTissue architecture, storage materialIdentifies structural abnormalities
Electron microscopyLysosomal ultrastructureReveals subtle morphological changes
Lysosomal enzyme assaysActivity of multiple enzymesFunctional assessment of lysosomes
Autophagy flux assaysLC3-II conversion, p62 levelsMeasures dynamic autophagy processes
Apoptosis assaysCaspase activation, PARP cleavageDetermines cell death pathways
Stress response experimentsSurvival under various stressorsReveals conditional phenotypes
Age-dependent phenotypingProgressive changes over timeIdentifies late-onset manifestations

The apparent normal phenotype in knockout mice despite cellular effects observed in knockdown studies suggests potential compensatory mechanisms or context-dependent functions that vary based on cell type or physiological state.

How does TMEM192 potentially regulate autophagy and apoptotic pathways?

TMEM192 has been implicated in regulating autophagy and apoptosis based on studies showing that knockdown in hepatoma cells leads to dysregulation of autophagy and increased apoptosis . Methodological approaches to investigate these relationships include:

  • Autophagy assessment:

    • Monitor autophagy markers (LC3-I to LC3-II conversion, p62 levels) in TMEM192-deficient versus control cells

    • Examine autophagosome and autolysosome formation using fluorescent markers

    • Measure autophagic flux using lysosomal inhibitors like Bafilomycin A1

  • Apoptosis evaluation:

    • Measure caspase activation, PARP cleavage, and annexin V binding

    • Assess lysosomal membrane permeabilization as a potential mechanism linking lysosomal function to apoptosis

    • Perform rescue experiments with wild-type or mutant TMEM192

  • Interaction studies:

    • Identify TMEM192-interacting proteins involved in autophagy or apoptosis

    • Investigate whether TMEM192 affects the recruitment of autophagy machinery to lysosomes

The lysosomal localization of TMEM192 suggests it may influence autophagy through effects on lysosomal function or autophagosome-lysosome fusion, while its potential role in apoptosis might relate to lysosomal membrane integrity.

What are the most effective experimental approaches for studying TMEM192 trafficking to lysosomes?

Understanding TMEM192 trafficking to lysosomes is facilitated by the knowledge that dileucine motifs at the amino-terminus mediate its lysosomal targeting . Effective experimental approaches include:

  • Live-cell imaging with fluorescently tagged TMEM192 to track movement through the endosomal-lysosomal system in real-time.

  • Mutagenesis of the dileucine motifs followed by quantitative co-localization studies with lysosomal markers.

  • Temperature-block experiments (15°C to block early endosome exit; 20°C to block trans-Golgi exit) followed by temperature shifts to synchronize and track trafficking.

  • Co-localization studies with markers for different compartments (early endosomes: EEA1; late endosomes: Rab7; lysosomes: LAMP1/2).

  • Inhibitor studies using compounds that disrupt specific trafficking pathways (e.g., Brefeldin A for Golgi transport).

  • Pulse-chase experiments with photo-switchable fluorescent tags to determine trafficking kinetics with high temporal resolution.

These approaches can reveal not only the mechanisms of TMEM192 trafficking but also potential regulatory points for modulating lysosomal function in disease contexts.

How can recombinant TMEM192 be used in structure-function studies?

Recombinant TMEM192 provides a valuable tool for elucidating molecular mechanisms through structure-function studies:

ApplicationMethodologyExpected Insight
Localization studiesExpression of tagged wild-type and mutant versionsIdentification of trafficking motifs
Dimerization analysisCo-IP of differentially tagged constructsMechanisms of dimer formation
Domain mappingExpression of truncation constructsEssential functional regions
Interaction screeningPull-down assays with purified proteinBinding partners
Structural studiesPurification for crystallography or cryo-EMMolecular architecture
Functional reconstitutionIncorporation into liposomesTransport or enzymatic activities

When designing constructs for recombinant expression, consider:

  • Strategic placement of affinity tags to avoid interference with functional domains

  • Selection of expression systems appropriate for membrane proteins

  • Inclusion of purification strategies that maintain native conformation

These structure-function studies can provide critical insights into how TMEM192 performs its cellular roles and may reveal potential therapeutic targets for lysosomal disorders.

What are the challenges in purifying recombinant TMEM192 and how can they be overcome?

Purifying recombinant TMEM192 presents several challenges typical of membrane proteins:

  • Expression challenges:

    • Problem: Low expression levels in heterologous systems

    • Solutions: Optimize codon usage, use specialized expression systems (insect cells, Pichia pastoris), lower expression temperature (25-30°C), induce with lower concentrations for longer periods

  • Extraction and solubilization:

    • Problem: Difficulty extracting from membranes while maintaining structure

    • Solutions: Screen detergents systematically (start with DDM, LMNG, digitonin); consider nanodiscs or amphipols as alternatives

  • Maintaining dimeric state:

    • Problem: Preserving native disulfide-mediated dimerization

    • Solutions: Carefully control redox conditions; verify dimer formation through non-reducing SDS-PAGE

  • Stability concerns:

    • Problem: Membrane proteins often destabilize during purification

    • Solutions: Include stabilizing agents (glycerol, cholesterol); minimize purification time; maintain consistent temperature

  • Functional verification:

    • Problem: Ensuring purified protein retains native activity

    • Solutions: Develop assays based on known properties (dimerization, interaction with binding partners)

A systematic approach addressing these challenges can yield properly folded, functional recombinant TMEM192 suitable for structural and functional studies.

How do mutations in TMEM192 affect lysosomal function and cellular homeostasis?

While direct evidence of disease-causing mutations in TMEM192 is currently limited, systematic investigation of how mutations affect lysosomal function can provide insights into its physiological roles. Experimental approaches should target:

  • Key structural elements:

    • Dileucine motifs involved in lysosomal targeting

    • Cysteine residue(s) responsible for dimerization

    • Conserved residues across species

  • Functional parameters to assess:

    • Lysosomal pH regulation

    • Lysosomal enzyme activities

    • Membrane integrity

    • Autophagy flux

    • Cell survival under stress conditions

  • Systematic mutation analysis workflow:

    • Generate panel of point mutations and deletion constructs

    • Assess localization using fluorescence microscopy

    • Evaluate dimerization by non-reducing SDS-PAGE

    • Measure functional parameters using established assays

    • Test cellular resilience under various stress conditions

This systematic approach can reveal domains critical for TMEM192 function and provide insights into how dysfunction might contribute to cellular pathology. The paradoxical mild phenotype in knockout models despite evidence for important cellular functions may reflect compensatory mechanisms that could be therapeutically relevant.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.