Recombinant Mouse Transmembrane protein 199 (Tmem199)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and pre-arranged. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Tmem199; Transmembrane protein 199
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-208
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Tmem199
Target Protein Sequence
MASSLLAGERLVRALGPGGELEREQLPRKLRAQLEAALGKKHAGSDNATGPRRLVSFRLI RDLHQHLRERNSRLYLHELLEGSDIYFPEIVKPPRNPELVARLEKIKIQLANEEYKRITR NVTCQDAQCGGTLSDLGKQVRSVKALVVTIFNFIITVAAAFVCTYLGSQYVFTEMASRVL AALIVASVVGLAELYVMVRAMEGELGEL
Uniprot No.

Target Background

Function
Recombinant Mouse Transmembrane protein 199 (Tmem199) is an accessory component of the vacuolar (V)-ATPase proton pump, playing a crucial role in intracellular iron homeostasis. Under aerobic conditions, it is essential for maintaining intracellular iron balance. This function triggers the activity of Fe(2+) prolyl hydroxylase (PHD) enzymes, leading to HIF1A hydroxylation and subsequent proteasomal degradation. Tmem199 is also necessary for endolysosomal acidification and lysosomal degradation and may be involved in Golgi homeostasis.
Database Links
Subcellular Location
Cytoplasmic vesicle, COPI-coated vesicle membrane; Multi-pass membrane protein. Endoplasmic reticulum-Golgi intermediate compartment membrane; Multi-pass membrane protein. Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is Mouse Transmembrane protein 199 (Tmem199)?

Mouse Transmembrane protein 199 (Tmem199) is a multi-pass membrane protein that functions as an accessory component of the proton-transporting vacuolar (V)-ATPase protein pump. It is homologous to the yeast V-ATPase assembly factor Vph2p (also known as Vma12p) and plays crucial roles in cellular homeostasis, particularly in endolysosomal acidification and iron homeostasis. Similar to its human counterpart, mouse Tmem199 is involved in activating Fe2+ prolyl hydroxylase (PHD) enzymes and maintaining proper Golgi function . The protein consists of multiple domains including transmembrane regions that anchor it to cellular membranes and functional domains that mediate its biological activities.

How does Tmem199 contribute to cellular physiology in murine models?

Tmem199 is essential for maintaining cellular homeostasis in mice through several mechanisms:

  • Endolysosomal acidification: Tmem199 contributes to the assembly and function of V-ATPase complexes, which are crucial for maintaining acidic pH in endosomes and lysosomes.

  • Protein glycosylation: Proper functioning of Tmem199 is necessary for normal glycosylation processes, particularly in the liver.

  • Iron homeostasis: Tmem199 is involved in maintaining intracellular iron balance by influencing the activity of Fe2+ prolyl hydroxylase enzymes.

  • Transcriptional regulation: Recent research indicates that Tmem199 may localize to the nucleus and participate in transcriptional regulation of immune-related genes .

Disruption of Tmem199 function in mice has been associated with metabolic abnormalities similar to those observed in human congenital disorders of glycosylation.

What is the subcellular localization pattern of Tmem199?

The subcellular localization of Tmem199 has been a subject of ongoing research and some controversy. Current evidence suggests multiple potential localizations:

Subcellular CompartmentEvidenceDetection Methods
Endoplasmic Reticulum (ER)Colocalization with ER markersImmunofluorescence, subcellular fractionation
ER-to-Golgi regionColocalization with ERGIC markersImmunofluorescence
Nuclear localizationDetection in nuclear fractions, binding to DNA regulatory elementsSubcellular fractionation, Cut&Tag assay
Membrane-associatedPresence of transmembrane domainsProtein sequence analysis

Recent research has revealed unexpected nuclear localization of Tmem199, where it may function as a transcriptional co-factor. This has been validated through multiple experimental approaches including live cell imaging with GFP-tagged Tmem199, subcellular fractionation followed by Western blotting, and 3D reconstructions by confocal microscopy .

What are the most effective methods for studying Tmem199 subcellular localization?

When investigating Tmem199 subcellular localization, researchers should employ multiple complementary approaches to avoid artifacts and confirm findings:

  • Immunofluorescence microscopy with careful fixation protocols: Use both paraformaldehyde (PFA) fixation and live cell imaging to rule out fixation artifacts. When using PFA fixation, use 0.025% Triton X-100 for permeabilization.

  • Subcellular fractionation with Western blotting: Extract proteins from different cellular compartments (cytoplasmic, membrane, nuclear, and chromatin-bound fractions) and perform Western blotting with Tmem199-specific antibodies.

  • Live cell imaging with fluorescent protein tags: Create GFP-tagged or other fluorescent protein-tagged Tmem199 constructs for live cell visualization, being careful to verify that the tag doesn't interfere with protein localization.

  • Co-immunoprecipitation coupled to mass spectrometry (co-IP/MS): This approach can identify Tmem199-interacting proteins and provide insights into its functional localization .

  • 3D confocal microscopy reconstruction: To definitively assess nuclear localization, use Z-stack imaging and 3D reconstruction to visualize the protein throughout the entire cellular volume.

Importantly, when studying nuclear localization, it's essential to rule out artifacts from membrane disruption by testing multiple fixation and permeabilization conditions, and validating findings with live cell imaging.

How can recombinant Mouse Tmem199 be efficiently produced for research applications?

Production of high-quality recombinant Mouse Tmem199 requires careful consideration of expression systems and purification strategies:

Expression Systems Comparison:

Expression SystemAdvantagesLimitationsYield (mg/L)
E. coliCost-effective, rapid expressionPoor for membrane proteins, lacks PTMs0.5-2
Insect cells (Baculovirus)Better folding, some PTMsModerate cost, slower production2-10
Mammalian cells (HEK293, CHO)Proper folding and PTMsHigher cost, complex protocols1-5
Cell-free systemsAvoids toxicity issues, rapidLimited PTMs, expensive0.1-1

Recommended Protocol for HEK293 Expression:

  • Clone the full-length mouse Tmem199 cDNA into a mammalian expression vector with an appropriate tag (His, FLAG, or Fc).

  • Transfect HEK293 cells and select stable transfectants.

  • Culture cells in serum-free media for 3-5 days.

  • Harvest cells and solubilize membrane proteins using mild detergents (e.g., 1% DDM or CHAPS).

  • Purify using affinity chromatography followed by size exclusion chromatography.

  • Validate protein quality by SDS-PAGE, Western blotting, and functional assays.

For nuclear localization studies, consider producing truncated fragments (such as the C1 and C3 fragments identified in human TMEM199) that maintain nuclear localization capability .

What knockout and knockdown strategies are most effective for Mouse Tmem199 functional studies?

Several genetic manipulation approaches can be employed to study Tmem199 function:

CRISPR/Cas9 Knockout Strategy:

  • Design multiple gRNAs targeting early exons of Tmem199 (preferably exons 2-3).

  • Validate gRNA efficiency using T7 endonuclease assay.

  • Transfect mouse cells with CRISPR/Cas9 components.

  • Screen clones using PCR and sequence verification.

  • Validate knockout at protein level using Western blotting.

shRNA/siRNA Knockdown Approach:

  • Design 3-4 different shRNA/siRNA sequences targeting different regions of Tmem199 mRNA.

  • Package shRNAs into lentiviral vectors for stable expression.

  • Establish knockdown efficiency through qRT-PCR and Western blotting.

  • Use scrambled shRNA/siRNA as negative controls.

Inducible Systems:
For developmental studies where complete knockout may be lethal, consider doxycycline-inducible knockdown systems or Cre-loxP conditional knockout approaches.

Validation Controls:

  • Rescue experiments with wild-type Tmem199 expression

  • Multiple independent knockdown/knockout clones

  • Off-target effect assessment

Recent studies have successfully employed lentiviral-based knockdown systems for TMEM199, which showed significant effects on immune checkpoint expression without affecting cancer cell proliferation directly .

How does Tmem199 regulate immune checkpoints and the tumor microenvironment?

Recent research has revealed a surprising role for Tmem199 in immune regulation, particularly in the context of cancer:

Regulatory Mechanism:
Nuclear-localized Tmem199 appears to function as a transcriptional co-factor that regulates immune checkpoint molecules, particularly PD-L1 (CD274). This regulation occurs through binding to transcription factors and co-factors such as IFNGR1, IRF1, MTMR9, and Trim28, which promote PD-L1 mRNA expression .

Key Experimental Findings:

  • Tmem199 knockdown decreases PD-L1 protein and mRNA levels in multiple cancer cell types.

  • Cut&Tag assay reveals binding of Tmem199 to promoter regions of immune regulatory genes.

  • In vivo tumor xenograft models show reduced tumor size with Tmem199 knockdown, despite no direct effect on cancer cell proliferation in vitro.

  • Immune cell infiltration analysis shows increased CD8+ and CD11b+ cells in Tmem199 knockdown xenografts .

Experimental Design for Studying Tmem199's Immune Regulation:

  • Compare Tmem199 knockdown effects in immunocompetent versus immunodeficient mouse models.

  • Analyze changes in tumor-infiltrating lymphocytes upon Tmem199 manipulation.

  • Perform ChIP-qPCR to confirm binding to immune checkpoint gene promoters.

  • Conduct co-immunoprecipitation studies to identify immune-related Tmem199 binding partners.

What role does Tmem199 play in lysosomal function and protein degradation?

Tmem199 functions as a critical regulator of lysosomal physiology:

Mechanisms of Lysosomal Regulation:

  • V-ATPase Assembly: Tmem199 assists in the assembly of V-ATPase components, critical for lysosomal acidification.

  • Lysosomal Quantity: Tmem199 knockdown has been shown to significantly decrease lysosome quantity.

  • Protein Degradation Pathways: Impaired lysosomal function due to Tmem199 deficiency affects the degradation of multiple proteins, including immune receptors .

Experimental Evidence:
Research shows that TMEM199 knockdown leads to decreased lysosome quantity as measured by LysoTracker staining. This impaired lysosomal function affects protein degradation pathways, particularly for proteins like PD-L1, EGFR, and HLA molecules that are partially degraded through lysosomes .

Methodological Approach for Studying Lysosomal Effects:

  • Use LysoTracker or LysoSensor dyes to quantify lysosome number and pH.

  • Perform protein degradation assays with translation inhibitors (e.g., cycloheximide).

  • Monitor autophagy markers (LC3-I/II, p62) in Tmem199-deficient models.

  • Assess lysosomal enzyme activities (cathepsins, acid phosphatase).

How do transcription factors interact with nuclear Tmem199 to regulate gene expression?

The unexpected discovery of nuclear Tmem199 has opened new research directions regarding its role in transcriptional regulation:

Transcriptional Regulatory Mechanism:
Nuclear Tmem199 appears to function as a transcriptional co-factor that interacts with various transcription factors to regulate gene expression. Cut&Tag assay and co-immunoprecipitation studies have identified several key interaction partners:

Transcription FactorFunctionEffect on Gene Expression
IFNGR1IFN-γ receptor componentPromotes PD-L1 expression
IRF1Interferon regulatory factorMediates IFN-γ-induced PD-L1 expression
KAT8Histone acetyltransferaseForms phase separation with IRF1 to regulate PD-L1
Trim28Transcriptional co-regulatorPromotes immune escape via PD-L1 upregulation
FOX family proteinsForkhead box TFsRegulate metabolism, inflammation, autophagy

Experimental Approach to Study These Interactions:

  • Perform ChIP-seq or Cut&Tag assays to map genome-wide binding sites.

  • Use Co-IP followed by Western blotting to confirm direct interactions.

  • Employ reporter gene assays to validate functional consequences of interactions.

  • Create truncated Tmem199 constructs to map interaction domains .

Recent research has demonstrated that transcription factor knockdown (IFNGR1, IRF1, c-Jun, KAT8, or Trim28) decreases CD274 mRNA levels, similar to the effect of Tmem199 knockdown, suggesting a cooperative transcriptional regulatory mechanism .

How can researchers resolve contradictory data about Tmem199 localization?

The subcellular localization of Tmem199 has yielded contradictory results across studies. To resolve these discrepancies:

Methodological Considerations:

  • Fixation artifacts: Different fixation methods can alter membrane integrity. Compare PFA-fixed cells with live cell imaging.

  • Antibody specificity: Validate antibodies using knockout controls and multiple antibodies targeting different epitopes.

  • Cell type differences: Tmem199 localization may vary between cell types; systematically compare localization across multiple cell lines.

  • Dynamic localization: Consider that Tmem199 may shuttle between compartments depending on cellular conditions.

Recommended Approach:

  • Employ multiple, complementary detection methods (immunofluorescence, subcellular fractionation, live imaging).

  • Use proper controls for each compartment (ER, Golgi, nuclear markers).

  • Create truncated constructs to identify localization signals, similar to the C1 and C3 fragments identified to mediate nuclear localization .

  • Consider using super-resolution microscopy techniques (STED, STORM) for more precise localization.

Research has confirmed that Tmem199 can be detected in multiple compartments including ER, ER-to-Golgi region, and nucleus, suggesting it may have multiple functional pools within cells .

What controls are essential when studying the effects of Tmem199 manipulation?

To ensure robust and reproducible results when manipulating Tmem199 expression:

Essential Controls for Knockdown/Knockout Studies:

  • Scrambled/non-targeting controls: Always include appropriate negative controls for RNAi or CRISPR studies.

  • Multiple knockdown/knockout clones: Generate and test multiple independent clones to rule out clonal artifacts.

  • Rescue experiments: Re-express wild-type Tmem199 to confirm phenotype specificity.

  • Expression validation: Confirm knockdown/knockout at both mRNA (qRT-PCR) and protein (Western blot) levels.

  • Off-target effect assessment: Use multiple siRNA/shRNA sequences or gRNAs.

Controls for Overexpression Studies:

  • Empty vector controls: Include appropriate backbone vector controls.

  • Expression level monitoring: Verify that expression levels are within physiological range.

  • Subcellular localization validation: Confirm that tagged proteins localize correctly.

Phenotypic Assessment Controls:

  • Positive controls: Include treatments with known effects (e.g., lysosomal inhibitors when studying lysosomal function).

  • Time course experiments: Monitor phenotypes at multiple time points to capture dynamic effects.

  • Multiple readouts: Use complementary assays to validate phenotypes.

When studying Tmem199's effect on PD-L1 expression, for instance, researchers should examine both mRNA and protein levels, perform flow cytometry to assess membrane expression, and include controls for the transcription factors involved in the pathway .

How should contradictory findings about Tmem199 function be interpreted?

When faced with conflicting data about Tmem199 function:

Analytical Framework:

  • Context dependency: Determine if differences are due to cell type, experimental conditions, or species differences.

  • Methodological differences: Evaluate if contradictions arise from different detection methods or experimental approaches.

  • Multifunctional protein hypothesis: Consider that Tmem199 may have multiple, context-dependent functions.

  • Temporal dynamics: Assess if conflicting results reflect different time points in dynamic processes.

Resolution Strategies:

  • Perform side-by-side comparisons under identical conditions.

  • Test multiple cell lines and primary cells to determine context-dependency.

  • Use complementary methods to validate findings.

  • Consider generating conditional knockouts to study temporal aspects of function.

For example, while TMEM199 has been primarily described as an ER/Golgi protein involved in V-ATPase assembly, recent research has revealed unexpected nuclear localization and immune regulatory functions . These findings suggest Tmem199 may have multiple functional roles depending on cellular context and localization.

How might Tmem199 serve as a therapeutic target in cancer immunotherapy?

Based on recent discoveries about Tmem199's role in immune regulation, several promising research directions emerge:

Mechanistic Rationale:
Tmem199 knockdown decreases PD-L1 expression and enhances anti-tumor immune responses in vivo, suggesting it may represent a novel target for cancer immunotherapy . Unlike direct targeting of immune checkpoints, modulating Tmem199 could affect multiple immune regulatory pathways simultaneously.

Potential Therapeutic Approaches:

  • Small molecule inhibitors: Developing compounds that disrupt Tmem199's interaction with transcription factors.

  • Targeted protein degradation: Using PROTACs or similar approaches to selectively degrade Tmem199.

  • Nuclear localization inhibitors: Preventing Tmem199 nuclear translocation by targeting the C1 and C3 domains responsible for nuclear localization .

Research Priorities:

  • Validate Tmem199 as immunotherapy target across multiple cancer types.

  • Identify small molecules that modulate Tmem199 activity (initial evidence suggests the proton pump inhibitor omeprazole decreases TMEM199 protein levels) .

  • Determine potential synergies between Tmem199 inhibition and existing immunotherapies.

  • Assess potential toxicity by studying effects of Tmem199 inhibition in normal tissues.

What is the relationship between Tmem199 and metabolic disorders?

Tmem199 has emerging connections to metabolic regulation:

Current Understanding:
Mutations in TMEM199 are associated with a rare genetic metabolic disease called congenital disorder of glycosylation (CDG), which manifests with developmental delays, hepatopathy, and coagulation dysfunction . TMEM199 deficiency is also linked to fatty liver disease caused by impaired lysosomal function .

Research Directions:

  • Create mouse models with Tmem199 mutations corresponding to human CDG-causing variants.

  • Investigate Tmem199's role in hepatic lipid metabolism and fatty liver disease.

  • Examine connections between Tmem199, lysosomal function, and metabolic regulation.

  • Study potential links between Tmem199 and nutrient sensing pathways.

Methodological Approaches:

  • Metabolomic profiling of Tmem199-deficient models.

  • Glycosylation analysis of secreted and membrane proteins.

  • Liver-specific conditional knockout models to avoid developmental issues.

  • High-fat diet challenges in Tmem199-manipulated mouse models.

How does Tmem199 interact with the V-ATPase complex in different cellular contexts?

Understanding the context-dependent interactions between Tmem199 and the V-ATPase complex represents an important research frontier:

Key Research Questions:

  • How does Tmem199 contribute to tissue-specific V-ATPase assembly and function?

  • Does nuclear Tmem199 regulate expression of V-ATPase components?

  • How do post-translational modifications affect Tmem199's interaction with V-ATPase?

  • What signaling pathways regulate Tmem199 localization and function?

Experimental Approaches:

  • Proximity labeling (BioID, APEX) to identify context-dependent Tmem199 interactors.

  • Tissue-specific knockout models to assess V-ATPase function across tissues.

  • Structural studies of Tmem199-V-ATPase component interactions.

  • Phosphoproteomics to identify regulatory post-translational modifications.

By pursuing these research directions, investigators can develop a more comprehensive understanding of Tmem199's multifaceted roles in cellular physiology and disease.

What are the most reliable antibodies and reagents for Mouse Tmem199 research?

While specific commercial antibodies for mouse Tmem199 may vary in quality and applications, researchers should consider the following selection criteria:

Antibody Selection Guidelines:

  • Validate specificity using knockout or knockdown controls

  • Test in multiple applications (Western blot, IP, IF, FACS)

  • Confirm species reactivity (mouse-specific vs. cross-reactive)

  • Select antibodies targeting different epitopes for confirmation

Recommended Reagents for Expression Studies:

  • Validated qRT-PCR primers spanning exon-exon junctions

  • Luciferase reporter constructs containing Tmem199 promoter

  • CRISPR/Cas9 constructs targeting early exons

  • Expression vectors with various tags (His, FLAG, GFP) for different applications

Controls and Standards:

  • Recombinant mouse Tmem199 protein as Western blot standard

  • Plasmids containing truncated Tmem199 domains for localization studies

  • Cell lines with verified Tmem199 knockout as negative controls

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.