Recombinant Mouse Transmembrane protein 204 (Tmem204)

Shipped with Ice Packs
In Stock

Description

Functional Roles in Biomedical Research

Tmem204 regulates cellular and physiological processes through its interaction with key pathways:

Key Functions

  • Angiogenesis & Vascular Development: Modulates vascular endothelial growth factor (VEGF) signaling via interactions with KDR and FLT4 receptors .

  • Cell Adhesion: Co-localizes with β-catenin at adherens junctions, reducing intercellular adhesion upon overexpression .

  • Cancer Prognosis: Upregulated in liver hepatocellular carcinoma (LIHC) and correlates with immune infiltration (e.g., CD8+ T cells, macrophages) .

  • Hypoxia Response: Induced under low oxygen conditions, influencing endothelial cell behavior .

Interaction Partners

Protein/MoleculeRole in PathwayInteraction Score
KDR (VEGFR2)VEGF signaling, endothelial proliferation0.788
TJP1 (ZO-1)Tight junction regulation0.596
CLEC14AAngiogenesis regulation0.541

Applications in Research

Recombinant Mouse Tmem204 is utilized in:

  • Cancer Studies: Investigating LIHC prognosis and immune microenvironment modulation .

  • Vascular Biology: Modeling angiogenesis and vascular permeability .

  • Toxicology: Assessing chemical-induced gene expression changes (e.g., cadmium, lead acetate) .

Available Variants and Customization

Product IDSpeciesTagExpression System
TMEM204-16986M MouseHisMammalian Cells
RFL4395RF RatHisE. coli
TMEM204-9349M MouseHis-Fc-AviHEK293

Custom production options (5–9 weeks lead time) include species-specific modifications (e.g., zebrafish, bovine) .

Quality Control and Validation

  • Purity: Validated by SDS-PAGE (>80–90%) .

  • Activity: Functional assays confirm adherence to VEGF signaling and hypoxia-response pathways .

  • Cross-Reactivity: 97% sequence identity with human and rat orthologs enables cross-species studies .

Research Limitations and Future Directions

  • Limitations: Limited data on post-translational modifications in recombinant forms.

  • Opportunities: Explore therapeutic targeting in cancer and vascular diseases via CRISPR or antibody-based tools .

This synthesis integrates molecular, functional, and practical insights, positioning Recombinant Mouse Tmem204 as a vital tool for vascular biology and oncology research.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, but this can be adjusted to your specifications.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Tmem204; Clp24; Transmembrane protein 204; Claudin-like protein 24
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-226
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Tmem204
Target Protein Sequence
MTLQKLVATAVLVALVSLILNNAAAFTPNWVYQTLEDGRKRSVGLWKSCWLVDRGKGVTS PGTRTGQVDTHDCEVLGWGSESAGFQESRGTVKLQFDMMRACNLVATAALVVGQITFILG LTGLPLMSPESQCWEEAMAAAFQLASFVLVIGLVTFYRIGPYTNLSWSCYLNIGACLLAT LAAAMLIWNILHRREDCMAPRVIVISRSLTARFRRGLDNDYVESPC
Uniprot No.

Target Background

Function
This transmembrane protein influences paracellular permeability and appears to participate in cell-cell interactions via adherens junctions.
Gene References Into Functions
  1. CLP24, a novel regulator of VEGFR-2 and VEGFR-3 signaling pathways and normal lymphatic vessel structure. PMID: 20439428
Database Links
Subcellular Location
Cell junction, adherens junction. Cell membrane; Multi-pass membrane protein.

Q&A

What is Mouse Transmembrane protein 204 (TMEM204) and its known functions?

TMEM204 is a member of the TMEM family that plays a critical role in cell adhesion and cellular permeability at adherens junctions. Research indicates it regulates cell function and angiogenesis . Also known by synonyms including C16orf30, FLJ20898, claudin-like protein 24 (CLP24), and MGC111564, this protein has significant implications in cellular communication and tissue integrity . TMEM204's function appears to be conserved across species, though species-specific variations may exist in regulatory mechanisms.

What expression patterns of TMEM204 have been observed in normal versus disease tissues?

TMEM204 expression varies significantly between normal and disease tissues. In cancer research, TMEM204 has been found to be up-regulated in multiple cancer types . Specifically in liver hepatocellular carcinoma (LIHC), TMEM204 expression is significantly higher than in normal tissues across all histologic subtypes including hepatocellular carcinoma, fibrolamellar carcinoma, and hepatocholangiocarcinoma . This differential expression pattern suggests TMEM204 may serve as a potential diagnostic biomarker, particularly for LIHC.

How is recombinant mouse TMEM204 utilized in cancer research?

Recombinant mouse TMEM204 serves as a valuable tool in cancer research, particularly for studying its role in liver hepatocellular carcinoma. Research has demonstrated that high TMEM204 expression correlates with good prognosis in LIHC patients . This protein can be used in functional studies to investigate mechanisms behind this correlation. Additionally, recombinant TMEM204 enables researchers to examine its interactions with immune cells, as TMEM204 expression has been significantly correlated with infiltration of CD8+ T cells (Rho=0.202, P=1.58e-04), CD4+ T cells (Rho=0.256, P=1.39e-06), macrophages (Rho=0.203, P=1.48e-04), neutrophils (Rho=0.157, P=3.56e-03), and myeloid dendritic cells (Rho=0.193, P=3.04e-04) in the tumor microenvironment .

What methodological approaches can be used to study TMEM204's role in cell adhesion?

To investigate TMEM204's function in cell adhesion, researchers can employ the following methodological approaches:

  • Loss-of-function studies using siRNA knockdown or CRISPR-Cas9 to reduce or eliminate TMEM204 expression

  • Gain-of-function studies using purified recombinant mouse TMEM204 or overexpression systems

  • Cell adhesion assays to measure changes in adhesive properties following TMEM204 manipulation

  • Trans-epithelial/endothelial electrical resistance (TEER) measurements to assess changes in cellular permeability

  • Immunofluorescence microscopy to visualize TMEM204 localization at adherens junctions

  • Co-immunoprecipitation to identify binding partners at cell-cell junctions

These approaches allow researchers to elucidate TMEM204's specific contributions to adherens junction formation and function, building upon the established role of TMEM204 in cell adhesion and permeability .

What expression systems are optimal for producing recombinant mouse TMEM204?

Several expression systems are available for producing recombinant mouse TMEM204, each with distinct advantages:

Expression SystemAdvantagesApplications
Mammalian Cells (HEK293)Proper folding, post-translational modificationsFunctional studies, binding assays
E. coliHigh yield, cost-effectiveStructural studies, antibody production
Mus musculus cellsNative environment for mouse proteinSpecies-specific interaction studies

Various tags can be incorporated for purification and detection purposes, including His, Avi, and Fc tags . The choice of expression system should be guided by the intended research application and the requirement for post-translational modifications that may be critical for TMEM204 function.

What quality control measures should be implemented when working with recombinant mouse TMEM204?

Quality control for recombinant mouse TMEM204 should include:

  • Purity assessment through SDS-PAGE and/or HPLC

  • Identity confirmation via mass spectrometry and Western blotting

  • Activity verification through functional assays specific to TMEM204's role in adherens junctions

  • Endotoxin testing if the protein will be used in cell culture or in vivo experiments

  • Coefficient of variation (CV) calculation for replicated quality control samples to assess reproducibility, with CV < 30% considered acceptable for most applications

How can methylation analysis be applied to study TMEM204 regulation?

Methylation analysis of TMEM204 can provide insights into its epigenetic regulation, particularly in cancer research where TMEM204 methylation levels in LIHC were found to be higher than in normal tissues . The methodological approach includes:

  • Bisulfite conversion of DNA, which converts unmethylated cytosines to uracil while leaving methylated cytosines unchanged

  • Analysis using methylation-specific PCR or bisulfite sequencing

  • Quantification using the Beta value, which represents the ratio of methylated probe intensity to the sum of methylated and unmethylated probe intensity

  • Interpretation using established thresholds: Beta values of 0.7-0.5 indicate hypermethylation, while values of 0.3-0.25 indicate hypomethylation

  • Correlation of methylation patterns with TMEM204 expression and clinical outcomes

This analytical approach can reveal how epigenetic modifications influence TMEM204 expression in different tissue contexts and disease states.

How can co-expression analysis enhance understanding of TMEM204 function?

Co-expression analysis represents a powerful approach to understanding TMEM204's functional networks and regulatory mechanisms. Implementation steps include:

  • Generate gene expression data across multiple conditions or cell types

  • Apply co-expression analysis methods to identify genes with expression patterns similar to TMEM204

  • Construct gene modules containing TMEM204 and its co-expressed genes using methods like WGCNA (Weighted Gene Co-expression Network Analysis)

  • Perform functional enrichment analysis on these modules to identify biological pathways associated with TMEM204

  • Validate predicted functional associations through experimental approaches

This approach has successfully identified pathways associated with TMEM204, including the p53 signaling pathway and Fanconi anemia pathway . Co-expression analysis combined with functional enrichment has proven valuable for improving the identification and prioritization of trans-eQTLs (genetic variants that affect gene expression at a distance) .

How can proteomics and transcriptomics data be integrated to study TMEM204?

Integrating proteomics and transcriptomics data provides a comprehensive view of TMEM204 regulation and function. The OmicsEV R package offers a systematic approach for this integration :

  • Data depth assessment: Evaluate the number of identified and quantifiable features in each dataset

  • Data normalization: Visualize feature abundance distribution using boxplots and density plots

  • Batch effect evaluation: Apply silhouette width and principal component regression analysis

  • Biological signal assessment: Use protein complex correlation analysis, gene function prediction, and machine learning models

  • Multi-omics concordance analysis: Calculate mRNA-protein correlation metrics for both gene-wise and sample-wise correlations

This integrated approach can reveal post-transcriptional regulation of TMEM204 and identify discrepancies between transcript and protein levels that may have functional significance.

What computational tools are recommended for analyzing TMEM204 expression and function?

Several computational tools are particularly valuable for TMEM204 research:

  • OmicsEV: For comprehensive quality evaluation of RNA-seq and proteomics data tables, enabling researchers to assess data quality and optimize data processing methods

  • TIMER2.0 (Tumor Immune Estimation Resource): For analyzing correlations between TMEM204 expression and immune cell infiltration in different tumor types

  • STRING: For building Protein-Protein Interaction Networks to identify potential interaction partners of TMEM204

  • Webgestalt: For functional analysis of TMEM204 and its related genes

  • GEPIA2, UALCAN, and Oncolnc: For evaluating the prognostic potential of TMEM204 across different cancer types

These tools collectively provide a robust computational framework for exploring TMEM204 biology from multiple perspectives.

How can discrepancies in TMEM204 expression data across different studies be reconciled?

Researchers may encounter contradictory results regarding TMEM204 expression across different studies. These discrepancies can be addressed through:

  • Careful evaluation of study methodologies, including:

    • RNA extraction and quality assessment procedures

    • Expression quantification methods (qPCR, RNA-seq, microarray)

    • Normalization approaches and reference genes used

  • Implementation of batch effect correction using tools like OmicsEV, which provides methods for batch effect evaluation including PCA plots and silhouette width calculation

  • Consideration of tissue-specific effects, as TMEM204 expression patterns and prognostic significance vary across different cancer types

  • Assessment of tumor heterogeneity and microenvironmental factors that may influence TMEM204 expression

  • Replication studies with larger sample sizes and standardized protocols

Understanding the methodological differences between studies is essential for reconciling seemingly contradictory findings about TMEM204 expression and function.

What are the best practices for validating functional studies using recombinant mouse TMEM204?

Validation of functional studies with recombinant mouse TMEM204 should include:

  • Multiple complementary assays to measure the same biological phenomenon

  • Appropriate controls including:

    • Vehicle-only controls

    • Heat-inactivated recombinant protein

    • Isotype controls for antibody-based detection

  • Dose-response experiments to establish concentration-dependent effects

  • Genetic validation through:

    • siRNA knockdown of endogenous TMEM204

    • Rescue experiments using recombinant protein in knockout systems

  • Cross-validation with human TMEM204 to assess species-specific differences

  • Reproducibility assessment using the coefficient of variation (CV), with CV < 30% considered acceptable for most biological assays

Following these validation practices ensures robust and reproducible results when studying recombinant mouse TMEM204 function.

How might TMEM204 function in immune regulation based on current evidence?

TMEM204's role in immune regulation represents an emerging research direction based on its correlation with immune cell infiltration in tumors. In LIHC, TMEM204 expression significantly correlates with infiltration of CD8+ T cells, CD4+ T cells, macrophages, neutrophils, and myeloid dendritic cells . These correlations suggest several potential functions:

  • Regulation of immune cell recruitment or retention in tissue microenvironments

  • Modulation of immune checkpoint pathways

  • Influence on antigen presentation processes

  • Contribution to cytokine signaling networks

  • Role in maintaining tissue-specific immune homeostasis

Investigating these potential functions using recombinant mouse TMEM204 in immune cell co-culture systems could provide valuable insights into TMEM204's role in immunobiology.

What is known about TMEM204's potential role in developmental biology?

While the search results provide limited direct information on TMEM204's role in development, its functions in angiogenesis and cell adhesion suggest important developmental contributions. Future research directions could include:

  • Temporal expression analysis during embryonic development

  • Tissue-specific knockout studies to assess developmental phenotypes

  • Lineage tracing experiments to identify TMEM204-expressing progenitor populations

  • Investigation of TMEM204's role in tissue morphogenesis and organogenesis

  • Analysis of potential genetic variants affecting TMEM204 expression during development using techniques similar to those described for identifying trans-eQTLs

These approaches would help elucidate TMEM204's contributions to normal development and potentially reveal insights into developmental disorders.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.