Recombinant Mouse Transmembrane protein 205 (Tmem205)

Shipped with Ice Packs
In Stock

Description

Protein Architecture

Tmem205 is a multi-pass transmembrane protein with four predicted transmembrane helices (TMs) and extracellular N- and C-termini . A conserved intracellular domain (I-domain) between TM3 and TM4 is hypothesized to mediate platinum-drug transport . Recombinant versions often include N-terminal His-tags for purification (e.g., in E. coli or mammalian systems) .

FeatureDescriptionSource
Transmembrane helicesFour predicted TMs with extracellular termini
Intracellular domainLocated between TM3 and TM4; potential Pt(II)-recognition site
Recombinant tagsHis-tag (N-terminal) for affinity purification

Functional Interactions

  • Cisplatin Resistance: Overexpression of Tmem205 in cancer cells correlates with reduced intracellular cisplatin accumulation due to selective extrusion .

  • Immune Modulation: In hepatocellular carcinoma (HCC), low Tmem205 expression associates with increased M2 macrophages and regulatory T cells (Tregs), while high expression promotes CD8+ T-cell infiltration .

Expression Systems

Recombinant Tmem205 is produced in diverse platforms:

SystemSpeciesTagPurityApplicationsSource
E. coliMouseHisLyophilizedIn vitro drug transport assays
Mammalian (HEK293)Human, MouseHis≥95% SDS-PAGEELISA, immunofluorescence (IF)

Functional Validation

  • Drug Export Assays: Recombinant hTMEM205 (human ortholog) in E. coli demonstrated 2.5× increased cisplatin resistance compared to controls .

  • Immune Profiling: Tmem205 knockdown in HCC models reduced CD8+ T-cell infiltration and increased Treg markers (e.g., IL2RA) .

Prognostic Biomarker in HCC

Low Tmem205 expression in HCC correlates with:

ParameterHigh Tmem205Low Tmem205Source
CD8+ T-cell infiltration
M2 Macrophages
Tregs

Target for Overcoming Drug Resistance

Tmem205’s role in platinum-drug efflux makes it a candidate for combination therapies to enhance cisplatin efficacy . Mutagenesis studies identified conserved cysteine/methionine residues critical for Pt(II)-transport activity .

Research Challenges and Future Directions

  • Mechanistic Gaps: Direct evidence for Tmem205’s interaction with platinum complexes is limited to E. coli models .

  • Species-Specific Variability: Recombinant Tmem205 from mouse vs. human may have divergent functional outcomes .

  • Therapeutic Potential: Inhibitors targeting Tmem205’s Pt(II)-transport pathway could counteract resistance in cisplatin-treated cancers .

Table 1: Recombinant Tmem205 Production Platforms

SpeciesExpression SystemTagPurityApplicationsSource
MouseE. coliHisLyophilizedDrug transport assays
MouseHEK293His≥95%ELISA, IF, WB
HumanHEK293His≥95%Immune profiling, drug discovery

Table 2: Clinical Correlations in HCC

BiomarkerHigh Tmem205Low Tmem205Statistical SignificanceSource
OSBetterPoorp = 0.032
DSSBetterPoorp = 0.002
CD8+ T-cellsr = 0.26, p < 0.0001

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Our standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is crucial for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Tmem205; Transmembrane protein 205
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-189
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Tmem205
Target Protein Sequence
MEKGEDPGSLIKVIHLLVLSGAWGMQVWVTFISGFLLFRSLPRHTFGLVQSKVFPVYFHV SLGCAFINLCILAPQRAWIHLTLWEVSQLSLLLLSLTLATINARWLEARTTAVMRALQSI EKERGLGTEVPGNFQGPDPYRQLRDKDPKYSALRRKFYHYHGLSSLCNLGCLLSNGLCLV GLALGLRSL
Uniprot No.

Target Background

Database Links
Protein Families
TMEM205 family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is mouse Tmem205 and how does it compare to human TMEM205?

Mouse Tmem205 is a transmembrane protein with significant homology to human TMEM205. The human homologue is 189 amino acids long with a molecular weight of 21.2 kDa and contains 4 hydrophobic helical domains that form transmembrane regions . Mouse Tmem205 shares approximately 88% sequence similarity with the human version while maintaining the same protein length of 189 amino acids . Both proteins are encoded by genes on the minus strand of their respective chromosomes, with the mouse ortholog exhibiting preserved structural features including the four transmembrane domains. Evolutionary conservation analysis suggests important biological functions that have been maintained across species divergence.

What expression patterns does Tmem205 exhibit in mouse tissues?

Tmem205 shows tissue-specific expression patterns primarily in secretory tissues. Similar to human TMEM205, the mouse protein demonstrates higher expression in secretory tissues including the thyroid, adrenal gland, pancreas, and mammary tissues . This expression pattern suggests potential roles in secretory pathways or membrane trafficking processes. When designing studies targeting Tmem205, researchers should consider these native expression patterns to select appropriate tissue models and establish baseline expression levels for comparison. Expression mapping across developmental stages shows variations that may correlate with secretory tissue maturation.

What are the recommended methods for detecting Tmem205 expression in mouse tissues?

Several approaches can be employed to detect Tmem205 expression:

  • RNA-level detection:

    • RT-qPCR using validated primers spanning exon junctions

    • RNA in situ hybridization for spatial expression analysis

    • RNA-Seq or microarray analysis for comparative expression studies

  • Protein-level detection:

    • Western blotting using validated antibodies against mouse Tmem205

    • Immunohistochemistry or immunofluorescence for tissue localization

    • Flow cytometry for cell-specific expression analysis

When designing primers or selecting antibodies, researchers should carefully validate specificity given the presence of conserved domains and potential cross-reactivity with other transmembrane proteins. Multiplexing with established secretory tissue markers can provide contextual information about expression patterns.

What are the critical considerations when designing experiments with recombinant mouse Tmem205?

When working with recombinant mouse Tmem205, researchers should consider:

  • Expression vector selection:

    • Mammalian expression vectors with appropriate promoters for target cell lines

    • Consideration of tag positioning (N- or C-terminal) to avoid disrupting transmembrane domains

    • Selection of fusion tags that won't interfere with membrane localization

  • Experimental controls:

    • Empty vector controls matched to expression construct backbone

    • Non-relevant transmembrane protein controls of similar size/complexity

    • Wild-type cells alongside transfected/transduced cells

  • Validation approaches:

    • Confirmation of correct localization to appropriate cellular compartments

    • Functional assessment to ensure recombinant protein maintains native activities

    • Dose-dependent expression analysis to assess potential toxicity or artifacts

A good experimental design requires significant planning to ensure control over the testing environment, sound experimental treatments, and proper assignment of subjects to treatment groups . For Tmem205 specifically, accounting for its transmembrane nature is essential in all experimental designs.

How can I optimize transfection efficiency for Tmem205 overexpression studies?

Optimizing transfection for Tmem205 overexpression requires:

  • Cell line selection:

    • Choose cell lines with endogenous Tmem205 expression when possible

    • Consider secretory cell lines that naturally express similar transmembrane proteins

    • Validate transfection compatibility with pilot studies

  • Transfection method optimization:

    • For lipid-based transfection: Test different reagent:DNA ratios (typically 2:1 to 4:1)

    • For electroporation: Optimize voltage and pulse duration based on cell type

    • Consider viral transduction for difficult-to-transfect cells or stable expression

  • Post-transfection protocols:

    • Allow 24-72 hours for proper protein folding and membrane integration

    • Implement selection strategies for stable cell line generation

    • Validate expression by Western blot and subcellular localization by microscopy

When applying your experimental design, remember that manipulating independent variables (like transfection conditions) while monitoring dependent variables (expression levels, localization) allows you to determine optimal relationships between these factors .

How should I design knockout experiments to study Tmem205 function?

Designing effective knockout experiments for Tmem205 requires:

  • Strategy selection:

    • CRISPR-Cas9 approach: Design sgRNAs targeting early exons (typically exon 1 or 2)

    • shRNA/siRNA approach: Design multiple targeting sequences to ensure knockdown

    • Conditional knockout: Consider tissue-specific or inducible systems for developmental studies

  • Validation framework:

    • Genomic validation: Sequencing to confirm targeted mutations

    • Transcript validation: RT-qPCR with primers spanning multiple exons

    • Protein validation: Western blotting and immunofluorescence

  • Control implementation:

    • Non-targeting guide RNA or scrambled RNA controls

    • Rescue experiments by re-expressing Tmem205 to confirm phenotype specificity

    • Heterozygous models to assess gene dosage effects

Your experimental design should provide unbiased estimates of inputs and associated uncertainties while enabling detection of differences caused by independent variables . For Tmem205, careful design of targeting strategies is crucial due to its transmembrane structure and potential functional domains.

What approaches can be used to study Tmem205 involvement in chemoresistance mechanisms?

Based on the observation that TMEM205 shows increased expression in tumor tissue resistant to platinum-based chemotherapy drugs , these methodologies are recommended:

  • In vitro resistance models:

    • Develop drug-resistant cell lines through chronic exposure to cisplatin or other platinum compounds

    • Compare Tmem205 expression in parent vs. resistant lines using qPCR and Western blotting

    • Manipulate Tmem205 expression (overexpression/knockdown) to assess impact on drug sensitivity using:

      • MTT/SRB viability assays

      • Flow cytometry for apoptosis assessment

      • Clonogenic survival assays

  • Mechanistic investigations:

    • Drug accumulation assays to measure intracellular platinum concentrations

    • Colocalization studies with known drug transporters

    • Pull-down experiments to identify Tmem205 interaction partners in resistant cells

  • Clinical correlation approaches:

    • Analysis of patient datasets with treatment response data (similar to approaches using LASSO regression, SVM-RFE, and RF-SRC methods )

    • Immunohistochemical validation in patient samples pre/post treatment

    • Correlation of expression with survival metrics in treated cohorts

These approaches enable researchers to assess multiple factors on outcomes while maintaining experimental control , which is critical for establishing causative relationships between Tmem205 and chemoresistance.

What are the recommended methods for studying Tmem205 protein interactions?

To investigate Tmem205 protein interactions:

  • Co-immunoprecipitation (Co-IP) approaches:

    • Epitope tag-based pull-downs (FLAG, HA, V5)

    • Optimized lysis conditions preserving membrane protein interactions:

      • Digitonin (0.5-1%)

      • CHAPS (0.5-2%)

      • Mild NP-40 (0.1-0.5%)

    • Negative controls including IgG and irrelevant tagged proteins

  • Proximity labeling techniques:

    • BioID or TurboID fusion with Tmem205

    • APEX2 fusion for rapid proximity labeling

    • Analysis by mass spectrometry with appropriate controls and statistical filtering

  • Microscopy-based techniques:

    • Fluorescence Resonance Energy Transfer (FRET)

    • Bimolecular Fluorescence Complementation (BiFC)

    • Proximity Ligation Assay (PLA) for endogenous protein interactions

  • Crosslinking mass spectrometry (XL-MS):

    • Chemical crosslinking with membrane-permeable reagents

    • Targeted isolation of Tmem205-containing complexes

    • MS/MS analysis to identify interaction sites

These methodologies allow researchers to manipulate variables while controlling the test environment , ensuring that observed interactions are specific to Tmem205 rather than experimental artifacts.

How can I analyze Tmem205 in single-cell RNA sequencing data?

For analyzing Tmem205 in single-cell RNA sequencing data:

  • Quality control and preprocessing:

    • Filter cells for quality metrics (number of genes, UMIs, mitochondrial content)

    • Normalize expression data using appropriate methods (e.g., SCTransform, LogNormalize)

    • Perform batch correction if analyzing multiple datasets

  • Expression analysis approaches:

    • Identify cell clusters expressing Tmem205 using dimensionality reduction (tSNE, UMAP)

    • Compare expression across defined cell types and states

    • Perform differential expression analysis to find genes correlated with Tmem205

  • Trajectory analysis:

    • Use pseudotime analysis to track Tmem205 expression changes during differentiation

    • Identify gene modules co-regulated with Tmem205

    • Apply RNA velocity to predict future expression states

  • Integration with spatial data:

    • Correlate single-cell profiles with spatial transcriptomics data

    • Map Tmem205-expressing cells to tissue regions

    • Validate with spatial techniques like FISH or Visium

Similar approaches have been used successfully to identify clinically-relevant TMEM genes using machine learning algorithms including LASSO regression, SVM-RFE, and random forest for survival, regression, and classification .

What functional assays are most appropriate for characterizing Tmem205 activity?

Given Tmem205's association with secretory tissues , these functional assays are recommended:

  • Membrane trafficking assays:

    • RUSH (Retention Using Selective Hooks) system to track protein trafficking

    • Pulse-chase experiments with fluorescent protein timers

    • Secretion assays measuring release of reporter proteins

  • Transport function assessment:

    • Fluorescent substrate uptake/efflux assays

    • Radioligand transport assays for potential substrates

    • Electrophysiological approaches if channel/transporter function is suspected

  • Secretory pathway integrity:

    • Brefeldin A sensitivity tests

    • Colocalization with secretory pathway markers

    • ER stress response monitoring following Tmem205 perturbation

  • Drug resistance mechanisms:

    • Cisplatin accumulation assays

    • DNA damage response assessment

    • Apoptosis pathway activation monitoring

How can I assess the role of Tmem205 post-translational modifications?

Investigating post-translational modifications (PTMs) of Tmem205:

  • Prediction and targeting:

    • In silico prediction of potential PTM sites (phosphorylation, glycosylation, ubiquitination)

    • Site-directed mutagenesis of predicted sites

    • Creation of PTM-specific antibodies when possible

  • Detection methods:

    • Phosphorylation: Phos-tag gels, phospho-specific antibodies, mass spectrometry

    • Glycosylation: PNGase F treatment, lectin blotting, glycoprotein staining

    • Ubiquitination: Immunoprecipitation under denaturing conditions, mass spectrometry

  • Functional assessment:

    • Compare wild-type vs. PTM-deficient mutants in functional assays

    • Assess impact of PTMs on protein localization, stability, and interactions

    • Monitor PTM changes under stress conditions or drug treatments

  • Temporal dynamics:

    • Pulse-chase labeling to track modification turnover

    • Inhibitor studies targeting specific modifying enzymes

    • Correlation with cellular events or signaling cascades

These approaches enable you to determine the relationship between variables by manipulating specific PTM sites and observing the downstream effects on Tmem205 function.

How conserved is Tmem205 across species and what can this tell us about its function?

Tmem205 demonstrates significant evolutionary conservation:

SpeciesCommon NameDivergence from Humans (MYA)Sequence SimilarityProtein Length
Homo sapiensHuman0100%189
Pan troglodytesChimpanzee6.4100%189
Pongo pygmaeusOrangutan15.899%189
Gorilla gorillaGorilla8.899%189
Callithrix jacchusCommon Marmoset43.996%189
Mus musculusMouse94.188%189
Sarcophilus harrisiiTasmanian Devil162.677%193
Crotalus adamanteusRattle Snake29685%188
XenopusXenopus37168%189

This conservation table provides valuable insights:

  • Functional importance: The high conservation across species suggests essential biological functions under selective pressure.

  • Structural constraints: The consistent protein length (primarily 189 amino acids) indicates structural constraints, likely related to membrane integration requirements.

  • Domain conservation: Comparative sequence analysis can reveal which domains are most conserved, pointing to functional regions.

  • Divergent regions: Areas of lower conservation may indicate species-specific adaptations or less functionally constrained regions.

Researchers can leverage this information by:

  • Targeting highly conserved regions when designing inhibitors or blocking antibodies

  • Using cross-species complementation assays to test functional conservation

  • Exploring species-specific differences to understand environmental adaptations

The consistently high conservation from humans to distantly related vertebrates suggests Tmem205 likely plays a fundamental biological role that evolved early in vertebrate evolution.

What are common challenges when working with recombinant Tmem205 and how can they be addressed?

Researchers working with recombinant Tmem205 often encounter these challenges:

  • Expression difficulties:

    • Challenge: Poor expression or toxicity in overexpression systems

    • Solutions:

      • Use inducible expression systems with titratable promoters

      • Try different cell lines, particularly those of secretory origin

      • Optimize codon usage for expression system

      • Consider lower temperature cultivation (30-33°C) to improve folding

  • Membrane integration issues:

    • Challenge: Protein aggregation or incorrect localization

    • Solutions:

      • Verify signal sequence functionality

      • Test different epitope tag positions and sizes

      • Implement proper controls to confirm membrane integration

      • Consider chimeric constructs with well-characterized transmembrane domains

  • Antibody specificity problems:

    • Challenge: Cross-reactivity or poor detection

    • Solutions:

      • Validate antibodies against knockout controls

      • Use multiple antibodies targeting different epitopes

      • Develop new antibodies against less conserved regions

      • Consider epitope-tagged versions for reliable detection

  • Functional assessment limitations:

    • Challenge: Unclear phenotypic readouts

    • Solutions:

      • Expand functional assays based on expression pattern (secretory tissues)

      • Test under stress conditions that might reveal conditional phenotypes

      • Consider relationship to chemoresistance mechanisms

      • Implement rescue experiments with mutations targeting specific domains

Addressing these challenges requires significant planning to ensure control over the testing environment , particularly when working with membrane proteins that have complex folding and localization requirements.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.