Recombinant Mouse Transmembrane protein 207 (Tmem207)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we will prioritize shipping the format currently in stock, we are happy to accommodate any specific format requirements. Please indicate your preferences in the order notes, and we will do our best to fulfill them.
Lead Time
Delivery time may vary depending on the purchasing method and location. For precise delivery estimates, please consult your local distributors.
Note: Our proteins are shipped standard with blue ice packs. If you require dry ice shipment, please communicate this in advance as additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. We suggest storing working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, we recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
The shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the protein's inherent stability. Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C, while lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
Please note that tag type is determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize its development for your order.
Synonyms
Tmem207; Transmembrane protein 207
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
30-143
Protein Length
Full Length of Mature Protein
Species
Mus musculus (Mouse)
Target Names
Tmem207
Target Protein Sequence
DLSCEENEMCVNYDERYPDGWYIWFFLLIFLVVLLCGVVLFCLQCWLKRCGINPPRRTMA VFAVGDLDPVYGAEMAGSPTSGICHPTQNTELCSAPCFGALGPPPPYEEILKAN
Uniprot No.

Target Background

Database Links
Subcellular Location
Membrane; Single-pass type I membrane protein.

Q&A

What is the molecular structure and cellular localization of mouse Tmem207?

Mouse Transmembrane protein 207 (Tmem207) is a membrane-localized protein with structural similarity to its human counterpart, which has 146 amino acid residues and a molecular mass of approximately 16.1 kDa . The protein contains a notable C-terminal proline-rich PPxY motif that serves as a binding site for WW domain-containing proteins . This motif is critical for its biological function, particularly its interaction with tumor suppressor proteins.

Tmem207 is primarily localized to cellular membranes, consistent with its classification as a transmembrane protein . Immunohistochemical studies have detected Tmem207 expression in specific cell types, including hair follicle bulge cells in non-tumorous skin of transgenic mouse models . In pathological contexts, Tmem207 has been identified in megakaryocytes and erythroblasts of transgenic mice exhibiting myeloproliferative disease-like phenotypes .

The gene encoding Tmem207 is evolutionarily conserved, with orthologs identified across multiple species including mouse, rat, bovine, frog, chimpanzee, and chicken . This conservation suggests fundamental biological roles for the protein that have been maintained throughout vertebrate evolution.

What are the primary biological functions of Tmem207 in normal mouse tissues?

The physiological functions of Tmem207 in normal mouse tissues remain incompletely characterized, though research has begun to elucidate its tissue distribution and potential roles. In non-pathological contexts, Tmem207 immunoreactivity has been detected in specific cell populations including hair follicle bulge cells . Additionally, the protein serves as a marker for Cortical Thick Ascending Limb Cells in kidney tissue, suggesting specialized functions in renal physiology .

The molecular interactions of Tmem207, particularly its binding to WWOX via the PPxY motif, indicate potential roles in regulating cellular stress responses . WWOX is involved in endoplasmic reticulum (ER) stress-induced apoptosis pathways, and Tmem207 may modulate these processes under normal physiological conditions .

Experimental approaches to studying Tmem207's normal functions have included immunohistochemical analyses of tissue specimens and generation of transgenic mouse models with altered Tmem207 expression . These methodologies have provided insights into tissue distribution patterns while suggesting potential physiological roles that warrant further investigation through targeted loss-of-function studies.

How does Tmem207 contribute to cancer progression in experimental models?

Tmem207 has demonstrated significant cancer-promoting properties in multiple experimental models, primarily through enhancing invasion and metastatic capabilities. In vitro studies using gastric signet-ring cell carcinoma cell lines (KATO-III) showed that enforced expression of Tmem207 significantly increased Matrigel invasion activity without affecting cell proliferation rates . This invasive property depends on the integrity of the PPxY motif, as mutations in this domain abolished the invasion-promoting effects .

The molecular mechanism underlying Tmem207's pro-invasive function involves binding to WWOX, a recognized tumor suppressor. Through co-immunoprecipitation and western immunoblotting, researchers have demonstrated that Tmem207 binds to WWOX in a PPxY motif-dependent manner . This interaction appears to attenuate WWOX's tumor suppressive functions, thereby enhancing cancer cell invasion. Supporting this mechanism, siRNA-mediated downregulation of WWOX significantly increased the invasive capacity of KATO-III cells, mimicking the effect of Tmem207 overexpression .

In transgenic mouse models, ectopic expression of Tmem207 under the intestinal trefoil factor (ITF) promoter led to unexpected phenotypes including spontaneous cutaneous adnexal tumors in approximately 14% of female and 13% of male mice aged 6-12 months . Another transgenic line exhibited myeloproliferative disease-like features, characterized by increased CD117+ cells and dysplastic myeloid cells in bone marrow . These diverse oncogenic manifestations suggest Tmem207 may have context-dependent effects on cellular transformation and tumor progression.

What methodologies are most effective for studying Tmem207 protein-protein interactions in mouse models?

Investigating Tmem207 protein-protein interactions requires a multi-faceted approach combining biochemical, cell biological, and genetic techniques. Co-immunoprecipitation followed by western immunoblotting has proven effective for identifying interacting partners such as WWOX . This approach allowed researchers to demonstrate that Tmem207 binding to WWOX depends on the integrity of the PPxY motif . When implementing this methodology, researchers should use appropriate controls including PPxY motif mutants to verify binding specificity.

For more comprehensive identification of Tmem207 interactors, mass spectrometry-based proteomics following immunoprecipitation can reveal the broader interaction network. This approach can be complemented by proximity labeling techniques such as BioID or APEX, which allow identification of proteins in close spatial proximity to Tmem207 within living cells.

Fluorescence resonance energy transfer (FRET) or bimolecular fluorescence complementation (BiFC) provides spatial and temporal resolution of Tmem207 interactions in living cells. These techniques are particularly valuable for understanding dynamic interaction patterns in response to cellular stressors or signaling events.

In vivo validation of identified interactions can be achieved through the analysis of transgenic mouse models expressing wildtype or mutant forms of Tmem207, such as the C57BL/6-Tg (ITF-TMEM207) lines . Tissue-specific expression patterns and phenotypic consequences provide context for understanding the biological significance of protein interactions identified through biochemical approaches.

How does the insertion site of the Tmem207 transgene affect phenotypic outcomes in mouse models?

The insertion site of the Tmem207 transgene has demonstrated significant influence on phenotypic outcomes in transgenic mouse models, highlighting the importance of position effects in genetic manipulation studies. In one C57BL/6-Tg (ITF-TMEM207) mouse line, the transgene was inserted into the Atg4b gene on murine chromosome 1, resulting in a high incidence of myeloproliferative disease-like phenotype . This phenotype was not observed in other transgenic lines carrying the same construct, suggesting that disruption of Atg4b function, combined with Tmem207 overexpression, contributed to the disease manifestation .

In another transgenic line, the ITF-TMEM207 construct was inserted into a major satellite repeat sequence on chromosome 2, where no definite coding molecules were identified . This line exhibited a high incidence of spontaneous intradermal tumors resembling human cutaneous adnexal tumors . The distinct phenotypes observed across different transgenic lines emphasize the complex interplay between transgene expression and genomic context.

Methodologically, researchers should employ comprehensive genomic analysis techniques to identify transgene insertion sites, including whole genome sequencing or targeted approaches such as inverse PCR. Characterization of the genomic neighborhood surrounding the insertion site is essential for interpreting phenotypic outcomes. Additionally, creating multiple independent transgenic lines and comparing their phenotypes helps distinguish transgene-specific effects from those influenced by insertional mutagenesis.

What is the relationship between Tmem207 expression and endoplasmic reticulum stress response in cancer progression?

Tmem207 appears to function as a key modulator of endoplasmic reticulum (ER) stress responses in cancer cells, particularly through its interaction with WWOX. Research has revealed that WWOX serves as a tumor suppressor by sensitizing cancer cells to ER stress-induced apoptosis . Tmem207 impairs this tumor suppressor function by binding to WWOX via its PPxY motif, potentially protecting cancer cells from ER stress-mediated cell death .

The clinical significance of this relationship is illustrated by studies in oral squamous cell carcinoma (OSCC), where coexpression of Tmem207 with Clptm1L (another ER stress-related protein) was significantly associated with poor patient outcomes and increased lymph node metastasis . Clptm1L confers cancer cell survival through ER stress survival signaling, while Tmem207 counteracts WWOX-mediated apoptosis, creating a synergistic effect that promotes cancer progression .

Protein Expression PatternAssociation with Lymph Node MetastasisPatient Outcome
Tmem207+/Clptm1L+Strong (P=0.000574)Poor (P=0.00252)
Tmem207+/Clptm1L−ModerateIntermediate
Tmem207−/Clptm1L+ModerateIntermediate
Tmem207−/Clptm1L−WeakFavorable

To study this relationship experimentally, researchers should employ methods for inducing and measuring ER stress responses, such as treatment with tunicamycin or thapsigargin, combined with analysis of unfolded protein response (UPR) markers. Genetic manipulation through CRISPR-Cas9 editing of Tmem207 or WWOX, coupled with assessment of cancer cell survival under ER stress conditions, can elucidate the molecular mechanisms underlying this relationship.

What techniques are most reliable for detecting and quantifying Tmem207 expression in mouse tissue samples?

Reliable detection and quantification of Tmem207 expression in mouse tissue samples require a combination of complementary techniques addressing protein and mRNA levels. Immunohistochemistry (IHC) using validated anti-Tmem207 antibodies has been successfully employed in multiple studies to detect protein expression patterns in tissue sections . This approach is particularly valuable for assessing spatial distribution, revealing that Tmem207 is expressed in specific cell populations such as hair follicle bulge cells in non-tumorous skin and megakaryocytes and erythroblasts in bone marrow .

When implementing IHC, researchers should employ appropriate positive and negative controls, including tissues from Tmem207 knockout mice when available. Antibody specificity should be validated through western blotting and peptide competition assays. For quantitative assessment of IHC results, digital image analysis using software platforms that can distinguish cellular compartmentalization is recommended.

At the mRNA level, quantitative RT-PCR provides sensitive detection of Tmem207 transcript abundance. Primers should be designed to span exon-exon junctions to prevent amplification of genomic DNA. In situ hybridization offers spatial information complementary to IHC, allowing visualization of Tmem207 mRNA distribution within tissue contexts.

For comprehensive expression analysis in complex tissues, single-cell RNA sequencing can reveal cell type-specific expression patterns that might be obscured in bulk tissue analyses. This approach is particularly valuable for heterogeneous tissues such as tumors or bone marrow, where Tmem207 may be expressed in specific cellular subpopulations.

How do transgenic mouse models of Tmem207 overexpression compare to human disease phenotypes?

Transgenic mouse models overexpressing Tmem207 have demonstrated phenotypes that parallel certain aspects of human diseases, though with important distinctions that highlight both the utility and limitations of these models. The C57BL/6-Tg (ITF-TMEM207) mouse line exhibiting myeloproliferative disease-like phenotype shows increased CD117+ cells and dysplastic myeloid cells in bone marrow, features reminiscent of human myeloproliferative diseases . This model may provide insights into precursor manifestations of diseases such as acute myelogenous leukemia (AML) and myelodysplastic syndromes (MDS).

Another transgenic line developed spontaneous intradermal tumors histopathologically resembling various human cutaneous adnexal tumors . With tumors appearing in approximately 14% of female and 13% of male mice aged 6-12 months, this model recapitulates aspects of human cutaneous adnexal neoplasms, which have shown increased incidence rates since 1980 .

When evaluating these models, researchers should consider both the similarities and differences compared to human disease presentations. Factors including differences in lifespan, tissue architecture, immune system composition, and genetic background can influence phenotypic manifestations and should be accounted for when extrapolating findings to human pathology.

What are the optimal conditions for producing high-quality recombinant mouse Tmem207 protein?

Production of high-quality recombinant mouse Tmem207 protein presents unique challenges due to its transmembrane nature, which affects solubility and proper folding. Bacterial expression systems such as E. coli often struggle with correct folding of membrane proteins, though they can be effective for producing isolated domains like the C-terminal region containing the PPxY motif. For expression of full-length Tmem207, eukaryotic systems including insect cells (Sf9, Sf21) or mammalian cells (HEK293, CHO) typically yield better results with appropriate post-translational modifications.

When designing expression constructs, researchers should consider incorporating purification tags (His, GST, or MBP) that can be cleaved post-purification. The inclusion of chaperone proteins or growth at reduced temperatures (16-18°C) can enhance proper folding in bacterial systems. For membrane protein expression, addition of detergents (DDM, CHAPS) during protein extraction and purification is essential for maintaining protein solubility and native conformation.

Protein quality should be assessed through multiple complementary methods including SDS-PAGE for purity, circular dichroism for secondary structure analysis, and functional assays such as binding studies with known interaction partners like WWOX. Mass spectrometry can verify the protein sequence and identify post-translational modifications.

For applications requiring native-like membrane environments, reconstitution into nanodiscs or liposomes may preserve protein structure and function better than detergent solubilization alone. These approaches are particularly valuable for structural studies and for investigating Tmem207's interactions with membrane components.

What experimental approaches can differentiate between direct and indirect effects of Tmem207 on cancer cell invasion?

Differentiating between direct and indirect effects of Tmem207 on cancer cell invasion requires a systematic experimental strategy combining genetic manipulation, protein interaction studies, and real-time cellular analyses. Structure-function relationship studies have been particularly informative, demonstrating that mutations in the PPxY motif abolish Tmem207's invasion-promoting effects in KATO-III gastric cancer cells . This approach identifies specific protein domains responsible for the observed phenotypes.

Rescue experiments provide compelling evidence for direct effects. After Tmem207 knockdown reduces invasion, reintroduction of wildtype Tmem207 (but not PPxY motif mutants) should restore the invasive phenotype if the effect is direct. Similarly, WWOX knockdown phenocopies Tmem207 overexpression in invasion assays, supporting a direct mechanistic link through this interaction partner .

Temporal analyses using inducible expression systems allow researchers to distinguish immediate from delayed effects of Tmem207 expression. Direct effects typically manifest rapidly after protein induction, while indirect effects involving transcriptional changes or secondary signaling cascades emerge later. Real-time imaging of cell movement and invasion following Tmem207 induction can reveal the kinetics of its effects.

Molecular pathway dissection through selective inhibitors or genetic silencing of downstream effectors can identify the signaling networks mediating Tmem207's effects. For example, if inhibiting specific matrix metalloproteinases blocks Tmem207-induced invasion, these proteases likely function as downstream effectors rather than direct interaction partners.

How can researchers effectively model the interaction between Tmem207 and the tumor microenvironment?

Modeling the interaction between Tmem207 and the tumor microenvironment requires experimental systems that capture the complexity of multicellular interactions while allowing manipulation of Tmem207 expression. Three-dimensional co-culture systems combining Tmem207-expressing cancer cells with stromal components (fibroblasts, immune cells, endothelial cells) offer advantages over traditional 2D cultures by recapitulating tissue architecture and intercellular communication networks.

Organoid cultures derived from primary tumors or normal tissues allow manipulation of Tmem207 expression in a physiologically relevant context. These systems maintain tissue-specific differentiation and organization while permitting genetic modification through CRISPR-Cas9 or viral transduction approaches.

For in vivo modeling, conditional transgenic systems using tissue-specific promoters (beyond the ITF promoter used in existing models) would enable Tmem207 expression in specific cell populations. Complementing this approach, orthotopic transplantation of Tmem207-modified cancer cells into immunocompetent or immunodeficient mice allows assessment of tumor-microenvironment interactions in a whole-organism context.

Single-cell RNA sequencing of Tmem207-expressing tumors and their microenvironment can reveal cell type-specific transcriptional responses and intercellular signaling networks. This approach is particularly valuable for identifying non-cell-autonomous effects of Tmem207 expression on surrounding stromal and immune cells.

Intravital imaging of Tmem207-expressing tumors using window chamber models enables real-time visualization of cancer cell interaction with the microenvironment, including processes such as invasion, angiogenesis, and immune cell recruitment. When combined with fluorescent reporters for specific signaling pathways, this approach provides dynamic information about Tmem207's influence on tumor-microenvironment communication.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.