Recombinant Mouse Transmembrane protein 212 (Tmem212)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Please note that we will prioritize shipping the format currently available in our inventory. However, if you have a specific format preference, please indicate it in your order notes, and we will accommodate your request to the best of our ability.
Lead Time
Delivery times may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery details.
All protein shipments are sent with standard blue ice packs. If you require dry ice packaging, please communicate with us in advance, as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
For optimal reconstitution, we recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. Customers can use this as a reference point.
Shelf Life
The shelf life of our proteins is influenced by several factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein itself.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C, while lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. For multiple uses, aliquoting is necessary. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The specific tag type will be determined during production. If you have a preferred tag type, please inform us, and we will prioritize its development.
Synonyms
Tmem212; Transmembrane protein 212
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-187
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Tmem212
Target Protein Sequence
MKGLYQAAGRTLVTLGGLSIFSGAIAFFPVFSCKLWYTGWSVWIACPIWNGALAVTAGSL VLLAHREWTQRHLWEAVFTFVILSILGCPLHFTVALQSALLGPYCFYSFSGVAGTNYLGY VVTFPFPYTKFPSVCVDPLHYEEYHLTLQVLDLCLSLILFCVSLAVFIKLSARLMQTGYI NGPENPQ
Uniprot No.

Target Background

Database Links

KEGG: mmu:208613

UniGene: Mm.59189

Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is Mouse Transmembrane Protein 212 and what experimental systems are available for its study?

Mouse Transmembrane Protein 212 (TMEM212) is a membrane-spanning protein encoded by the TMEM212 gene (GeneID: 208613) with a corresponding UniProt entry of Q8C6V3 . The protein consists of 564 base pairs as indicated in available vector constructs, suggesting a relatively small transmembrane protein compared to other membrane-spanning proteins . TMEM212 has also been associated with the alias FLJ23172, which may appear in older literature references .

For experimental studies, researchers can utilize several systems including lentiviral vectors and ELISA-based detection methods. The pLenti-GIII-CMV system offers a CMV promoter-driven expression of TMEM212 without tags or reporters, providing a clean system for studying native protein function . This vector system is particularly useful for difficult-to-transfect cell types as lentiviral delivery ensures high transduction efficiency. For protein detection and quantification, sandwich ELISA assays with a detection range of 0.156-10 ng/ml are available, allowing for sensitive measurement of TMEM212 in tissue homogenates, cell lysates, and other biological fluids .

When designing initial experiments, researchers should consider whether their questions require overexpression systems (using lentiviral vectors) or detection of endogenous protein (using ELISA approaches). The choice of experimental system should align with specific research objectives, whether investigating protein localization, interaction partners, or functional effects in specific cell types or tissues.

How should I properly store and handle recombinant TMEM212 vectors and reagents?

Proper storage and handling of TMEM212 research materials is critical for maintaining experimental integrity and reproducibility. For TMEM212 lentiviral vectors, storage at -20°C or lower in a non-frost-free freezer is recommended, with an expected stability of up to one year under these conditions . When working with lentiviral preparations, it's essential to aliquot the stock into smaller working volumes prior to freezing, as each freeze-thaw cycle can result in approximately 5% reduction in viral activity .

ELISA kits for TMEM212 detection require different handling protocols. Upon receipt, these kits should be stored according to the manufacturer's instructions enclosed in the kit manual . The stability of ELISA reagents is typically maintained for 6 months when stored properly, with activity loss rates of less than 5% within the expiration period . To ensure consistent results, it is advisable that the same researcher performs all assays within a given experiment to minimize technical variation.

Temperature fluctuations represent a significant threat to reagent integrity. When working with lentiviral vectors, maintain a controlled temperature environment during thawing and use the vectors promptly once thawed. For long-term studies, researchers should consider creating master stocks that remain untouched, with separate working stocks for routine experiments to preserve the integrity of the original material.

What experimental controls should be implemented when studying recombinant TMEM212?

Implementing appropriate experimental controls is fundamental to generating reliable and interpretable data when studying TMEM212. For lentiviral transduction experiments, essential controls include: 1) a mock-transduced control (cells exposed to the transduction procedure without virus), 2) an empty vector control (vector without the TMEM212 insert), and 3) a positive control using a well-characterized gene such as GFP to confirm transduction efficiency . These controls allow researchers to distinguish between effects specific to TMEM212 and those resulting from the experimental procedure or vector backbone.

When designing between-subjects or within-subjects experiments, careful planning of control groups is necessary to account for confounding variables . For instance, if investigating TMEM212 effects on cellular functions, researchers should control for cell passage number, culture conditions, and timing of analyses. The assignment of experimental units to treatment groups should follow randomization procedures to minimize systematic bias .

For ELISA-based detection of TMEM212, standard curves must be prepared using the provided lyophilized standards, and sample concentrations should be diluted to fall within the mid-range of the detection range (0.156-10 ng/ml) for most accurate results . Additionally, running samples in triplicate can help identify and mitigate technical variability. When interpreting ELISA results, researchers should be aware that the kits are optimized for detection of native samples rather than recombinant proteins, which may have different sequences or conformations .

How can I verify successful expression of recombinant TMEM212 in my experimental system?

Verification of successful TMEM212 expression requires a multi-faceted approach combining complementary techniques. The most direct method involves quantitative measurement using ELISA, which can detect TMEM212 protein in tissue homogenates, cell lysates, and biological fluids with high sensitivity (detection range: 0.156-10 ng/ml) . When using this approach, samples must be appropriately diluted to fall within the assay's linear range for accurate quantification.

At the transcript level, researchers can employ quantitative PCR (qPCR) to measure TMEM212 mRNA expression. This technique is particularly valuable when working with lentiviral systems, as it allows confirmation of successful transduction and transcription before assessing protein levels. When designing qPCR primers, researchers should target regions specific to the mouse TMEM212 sequence (accession number NM_001164437.1) to avoid cross-reactivity with endogenous genes .

For localization studies, immunofluorescence microscopy using antibodies against TMEM212 or against any epitope tags engineered into the recombinant construct can provide spatial information about protein expression. This approach is especially relevant for transmembrane proteins like TMEM212, where proper membrane localization is crucial for function. When using lentiviral vectors for expression, evaluating transduction efficiency is essential, with cell lines such as 293T potentially showing efficiencies approaching 100%, while other cell types may show variable transduction rates as low as 10% .

What factors affect transduction efficiency when using TMEM212 lentiviral vectors?

Multiple factors influence transduction efficiency when using lentiviral vectors for TMEM212 expression, requiring systematic optimization for each experimental system. Cell type represents perhaps the most significant variable, with established lines like 293T typically showing excellent transduction rates (approaching 100%) while primary cells or specialized cell types may exhibit considerably lower efficiencies (as low as 10%) . This variability necessitates pilot experiments to determine optimal conditions for each target cell population.

The multiplicity of infection (MOI) directly impacts transduction success and expression levels. Higher MOI values provide more copies of the TMEM212 gene per cell, potentially increasing expression levels and the proportion of transduced cells. Importantly, MOI also affects antibiotic resistance in selection protocols, as cells containing multiple vector copies can withstand higher antibiotic concentrations . Researchers should establish appropriate selection conditions through antibiotic killing curves for their specific cell types.

Transfection reagents used during viral production significantly influence final viral titers. While lipid-based reagents work well for many applications, calcium phosphate transfection or specialized reagents like Lentifectin may yield higher viral titers for TMEM212 expression . Cell density during viral production should be maintained at approximately 80% confluence for optimal results. The choice of promoter driving TMEM212 expression also affects expression patterns and levels, with CMV providing high-level expression across many mammalian cell lines, while EF1-1α, UbC, SV40, and PGK promoters offer alternative expression profiles suitable for different experimental goals .

What are the optimal experimental design considerations for studying TMEM212 function in mouse models?

Designing rigorous experiments to investigate TMEM212 function requires careful planning of variables, treatments, and measurement methods. Begin by clearly defining your hypothesis about TMEM212 function and identifying appropriate independent variables (e.g., TMEM212 expression levels) and dependent variables (e.g., phenotypic changes) . This framework ensures that your experimental design directly addresses your research question rather than generating merely descriptive data.

When manipulating TMEM212 expression in vivo or in vitro, consider using multiple approaches to strengthen causal inferences. For instance, complement overexpression studies using lentiviral vectors with knockdown or knockout approaches to establish necessity and sufficiency of TMEM212 for observed phenotypes. The selection of appropriate promoters is crucial for in vivo studies; while CMV provides strong expression, tissue-specific promoters may be more suitable for physiologically relevant models . For persistent expression in undifferentiated cells or stem cells, consider the PGK promoter, which resists silencing through methylation or histone deacetylation .

Control for extraneous variables that might confound interpretation of TMEM212-specific effects. These include vector-related effects (controlled using empty vector transductions), stress responses to viral infection (controlled using irrelevant protein expressions), and cell-type specific responses (controlled using multiple cell types) . Between-subjects designs, where different experimental units receive different treatments, may be appropriate for terminal analyses, while within-subjects designs offer greater statistical power for longitudinal studies of TMEM212 function .

For phenotypic analysis, employ multiple complementary methods rather than relying on a single readout. Quantitative measurement of TMEM212 using ELISA should be complemented with functional assays relevant to your hypothesis. When presenting results, organize findings in well-structured tables rather than lists to facilitate comparative analysis . Finally, consider potential dose-response relationships between TMEM212 expression levels and phenotypic outcomes, as threshold effects may be present that influence interpretation of results.

How can I troubleshoot low expression or activity of recombinant TMEM212 in my experimental system?

Troubleshooting suboptimal TMEM212 expression requires systematic evaluation of multiple experimental parameters. Begin by confirming successful transduction using qPCR analysis of TMEM212 transcript levels, which will distinguish between transduction failure and post-transcriptional issues. For lentiviral systems, viral titer is a critical determinant of expression; if titers are low during production, optimize transfection conditions by adjusting cell density to approximately 80% confluence and considering alternative transfection methods such as calcium phosphate or specialized reagents like Lentifectin instead of standard lipid-based reagents .

Post-transduction cell health significantly impacts expression levels. The supernatant used for infection contains depleted media and viral components that may create stress for target cells, potentially shortening their lifespan compared to non-transduced controls . This stress can reduce protein expression even in successfully transduced cells. To mitigate this effect, supplement the culture medium after transduction and allow sufficient recovery time before analysis. Additionally, consider that the culture medium used for viral production (typically DMEM) may not be optimal for your target cells, necessitating a medium change after the minimal infection period.

Promoter silencing represents another common cause of declining expression over time. While the CMV promoter provides strong initial expression, it is susceptible to silencing in certain cell types, particularly during long-term culture or differentiation . For persistent expression, consider alternative promoters such as PGK, which resists silencing through methylation or histone deacetylation mechanisms . If using ELISA for protein detection, ensure that samples are appropriately diluted to fall within the assay's detection range (0.156-10 ng/ml) , as concentrations outside this range will yield inaccurate measurements.

If recombinant TMEM212 shows appropriate expression but lacks expected activity, consider potential structural issues. The transmembrane nature of TMEM212 requires proper membrane integration for function, which may be disrupted in overexpression systems. Additionally, verify that your experimental readouts are appropriate for detecting TMEM212 activity, as the specific functions of this protein may manifest in ways not captured by general cellular assays.

What methodological approaches are recommended for investigating TMEM212 protein interactions and signaling pathways?

Investigating TMEM212 protein interactions requires specialized approaches appropriate for transmembrane proteins. Co-immunoprecipitation (Co-IP) represents a foundational method, but requires careful optimization due to the hydrophobic nature of transmembrane domains. Use mild detergents such as digitonin or CHAPS that preserve membrane protein complexes while enabling solubilization. When working with lentiviral expression systems, consider incorporating epitope tags (though these are not present in the standard pLenti-GIII-CMV vector) or using antibodies against native TMEM212 for pull-down experiments.

Proximity-based labeling methods offer powerful alternatives for capturing transient or weak interactions that may be disrupted during traditional Co-IP. BioID or TurboID approaches, which involve fusion of a biotin ligase to TMEM212, allow biotinylation of proximal proteins that can subsequently be purified and identified by mass spectrometry. When designing these constructs, carefully consider the topology of TMEM212 to ensure the biotin ligase domain is positioned to access relevant interaction compartments. These approaches are particularly valuable for transmembrane proteins like TMEM212, as they can capture interactions in their native membrane environment.

For functional validation of identified interactions, implement genetic approaches including co-expression, knockdown, or knockout of putative interaction partners alongside TMEM212. The lentiviral system available for TMEM212 expression can be complemented with additional vectors targeting interaction partners to assess functional relationships. Quantitative assessment of interaction effects should incorporate appropriate controls and statistical analysis, with data presented in well-structured comparative tables rather than simple lists .

To map signaling pathways downstream of TMEM212, phosphoproteomic analysis comparing TMEM212-expressing cells with controls can identify differential activation of signaling nodes. This approach should be combined with targeted validation using phospho-specific antibodies and pharmacological or genetic perturbation of candidate pathways. When interpreting results, consider that overexpression of transmembrane proteins may alter membrane properties independently of specific protein functions, necessitating careful design of control conditions to distinguish specific from non-specific effects.

How does the choice of promoter affect the experimental outcomes when studying TMEM212 function?

For studies requiring sustained expression in undifferentiated cells or stem cells, the PGK (murine Phosphoglycerate Kinase-1) promoter offers significant advantages. This promoter resists silencing through methylation or histone deacetylation mechanisms , providing more consistent expression over extended experimental timelines. Alternative promoters such as EF1-1α (human elongation factor 1α-subunit) and UbC (human ubiquitin C) provide high-level expression with different cell-type specificities, with UbC offering equivalent expression across diverse species and tissue types .

The experimental question should guide promoter selection. For cell-type specific studies, consider that the EF1-1α promoter offers the highest percentage of cells expressing the transgene, followed by PGK and UbC, while PGK provides higher gene expression levels in positive cells . This distinction between breadth (percentage of expressing cells) and intensity (expression level per cell) represents an important consideration when designing experiments to investigate TMEM212 function in heterogeneous cell populations.

The choice between constitutive and inducible promoters must also be considered. While the search results focus on constitutive promoters , inducible systems offer valuable experimental control for studying acute effects of TMEM212 expression or for expressing potentially toxic constructs. When reporting experimental results, clearly specify the promoter used and characterize the resulting expression pattern, as these details significantly impact data interpretation and reproducibility.

What considerations are important when designing TMEM212 knockout or knockdown experiments?

Designing effective TMEM212 knockout or knockdown experiments requires careful consideration of targeting strategy, validation methods, and potential compensatory mechanisms. For CRISPR-Cas9 knockout approaches, guide RNA design should target early exons of the TMEM212 gene to ensure complete functional disruption. Given that the mouse TMEM212 gene sequence (accession number NM_001164437.1) encodes a 564bp insert, targeting the initial portion of this relatively small coding sequence is advisable. Multiple guide RNAs should be designed and tested to identify those with highest efficiency and specificity.

For RNA interference approaches, siRNAs or shRNAs targeting TMEM212 transcript can be delivered transiently or through lentiviral vectors for stable expression. When using lentiviral delivery, consider that factors affecting transduction efficiency with expression vectors will similarly impact knockdown vectors . These factors include cell type susceptibility to lentiviral infection, which can range from nearly 100% efficiency in cell lines like 293T to as low as 10% in less permissive cell types . Validation of knockdown efficiency is essential and should combine transcript quantification via qPCR with protein-level assessment using ELISA .

Control experiments are critical for rigorous interpretation. Include non-targeting control constructs that engage the same silencing machinery without targeting TMEM212 or any other mouse transcripts. This controls for non-specific effects of the knockdown machinery. Additionally, rescue experiments, where TMEM212 expression is restored using a construct resistant to the knockdown approach (e.g., containing silent mutations that prevent siRNA binding), provide powerful validation that observed phenotypes result specifically from TMEM212 depletion rather than off-target effects.

Consider the temporal aspects of gene silencing experiments. Acute knockdown may reveal immediate functions of TMEM212 but might miss compensatory mechanisms that emerge over time. Conversely, stable knockout models might trigger developmental compensation that masks the protein's normal function. Using inducible knockdown or knockout systems can help distinguish between acute and chronic effects of TMEM212 deficiency. Finally, when interpreting results, consider that complete elimination of protein function in knockout models versus partial reduction in knockdown models may reveal different aspects of TMEM212 biology.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.