Recombinant Mouse Transmembrane protein 216 (Tmem216)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Our standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, offered as a guideline.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt; aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
Tmem216; Transmembrane protein 216; Thymus atrophy-related protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-141
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Tmem216
Target Protein Sequence
MAPRDKRLSSTPLEVLFFLNGWYYATYFLLELLIFLYKGLLLPYPTANLVLDVVMLLLYL GIEVIRLFFGTKGNLCQRKMPLGISVALTFPSAMMASYYLLLQTYVLRLEAIMNSILLFF CGSELLLEMLTLATFSSMDRI
Uniprot No.

Target Background

Function
A component of a tectonically-organized complex essential for tissue-specific ciliogenesis. It may also regulate ciliary membrane composition.
Database Links
Subcellular Location
Membrane; Multi-pass membrane protein. Cytoplasm, cytoskeleton, cilium basal body. Note=Localizes at the transition zone, a region between the basal body and the ciliary axoneme.

Q&A

What is Transmembrane protein 216 (Tmem216) and what is its cellular localization?

Transmembrane protein 216 (Tmem216) is a ciliary transition zone tetraspan transmembrane protein that localizes to the base of primary cilia or adjacent basal body in ciliated cells. Immunostaining studies in ciliated cell lines (inner medullary collecting duct [IMCD3] and retinal pigment epithelium [hRPE]) have demonstrated this localization pattern, as marked by acetylated or glutamylated tubulin staining . This specific positioning at the ciliary transition zone is consistent with Tmem216's critical functions in ciliogenesis and ciliary maintenance.

What genetic disorders are associated with TMEM216 mutations?

Mutations in TMEM216 are linked to two related ciliopathies: Joubert syndrome (JBTS) and Meckel syndrome (MKS). These conditions represent a spectrum of developmental disorders with overlapping features. Research has confirmed that the JBTS2 and MKS2 genetic loci are allelic and result from mutations in TMEM216 .

The phenotypic spectrum associated with TMEM216 mutations includes:

PhenotypeClinical FeaturesMutation Pattern
Joubert Syndrome (JSRD)Nephronophthisis (45%), Polydactyly (45%), No retinal dystrophy or hepatic fibrosisVarious mutations including p.R73L founder mutation in Ashkenazi Jewish patients
Oro-Facio-Digital type VIPolydactyly with tongue tumors or multiple oral frenulaIdentified in specific JSRD patients
Meckel Syndrome (MKS)Skeletal dysplasia, more severe developmental defectsVarious truncating and missense mutations

A notable genetic finding is the p.R73L founder mutation identified in all patients of Ashkenazi Jewish descent tested (n=10) .

What is the expression pattern of Tmem216 during development?

In zebrafish, in situ hybridization with tmem216 antisense probe revealed wide distribution at 3 days post-fertilization (dpf) across multiple organs including the eye, pronephros, brain, liver, intestine, and muscle . Within the retina specifically, expression was observed in all neural retina layers (outer nuclear layer, inner nuclear layer, and ganglion cell layer), with this expression pattern maintained through 7-dpf .

RT-PCR analysis has demonstrated that TMEM216 mRNA is detectable in:

  • Freshly laid eggs

  • 7-dpf whole larvae

  • Adult eye tissue

  • Adult brain tissue

  • Adult skeletal muscle

In human embryonic tissues, in situ hybridization confirmed expression in the central nervous system, limb bud, kidney, and cartilage . This broad and relatively low-level expression pattern mirrors that of other Joubert syndrome and Meckel syndrome-associated genes.

What protein complexes does Tmem216 participate in?

Tmem216 functions as a component of the transition zone tectonic complex, a protein assembly critical for ciliary formation and function . This complex consists of multiple proteins associated with Meckel and Joubert syndromes, including:

  • Secreted protein: TCTN1

  • Transmembrane proteins: TCTN2, TCTN3, meckelin (TMEM67), and TMEM216

  • Intracellular proteins: B9 domain–containing protein 1 (B9D1), CEP290, Meckel syndrome type 1 protein (MKS-1), and coiled-coil and C2 domain-containing protein 2A (CC2D2A)

Biochemical studies have demonstrated that TMEM216 directly complexes with Meckelin (TMEM67), which is encoded by another gene mutated in both JSRD and MKS . The tectonic/B9 complex serves three critical functions:

  • Facilitation of cilia formation

  • Regulation of ciliary membrane protein localization (such as Arl13b)

  • Restriction of plasma membrane proteins from entering the ciliary compartment

How does deletion of Tmem216 affect photoreceptor development and function?

Tmem216 knockout zebrafish exhibit multiple defects in photoreceptor development, organization, and survival. The comprehensive effects include:

FeatureWild-type Zebrafishtmem216 Knockout Zebrafish
SurvivalNormalDeath before 21 days post-fertilization
Rod photoreceptor outer segment (4D2 marker)Normal immunoreactivitySignificantly reduced immunoreactivity
Cone photoreceptor outer segment (GNAT2 marker)Normal immunoreactivitySignificantly reduced immunoreactivity
TUNEL-positive nuclei in retinaMinimalMarkedly increased (indicating photoreceptor degeneration)
Photoreceptor ciliary axonemeNormal lengthShortened
Outer segment proteins (rhodopsin, GNAT2, red opsin)Properly localizedMislocalized to inner segment and cell bodies
Outer segment disc morphologyNormalAbnormal (shortened discs, vesicles/vacuoles within outer segment)

These findings demonstrate that while TMEM216 deletion does not prevent initial photoreceptor generation, it results in improper development and eventual degeneration . The combination of mislocalized outer segment proteins, shortened ciliary axoneme, and abnormal outer segment disc morphology suggests that TMEM216 plays essential roles in both the transport of proteins to the outer segment and the structural organization of the outer segment itself.

What molecular mechanisms mediate Tmem216's role in ciliogenesis?

Loss of TMEM216 function, either in patient fibroblasts or following siRNA knockdown, causes defective ciliogenesis and impaired centrosomal docking . These defects are associated with concomitant hyperactivation of RhoA and Dishevelled signaling pathways . This suggests that TMEM216 may regulate ciliary formation in part through modulation of these signaling cascades.

As a component of the transition zone complex, TMEM216 contributes to:

  • Establishment of proper ciliary composition through selective protein transport

  • Maintenance of the diffusion barrier between ciliary and plasma membrane compartments

  • Regulation of ciliary membrane protein localization (particularly for proteins like Arl13b)

The interplay between TMEM216 and other transition zone components appears critical for these functions, though the precise molecular interactions governing these processes require further characterization.

What methodological approaches are available for generating Tmem216 knockout models?

The generation of tmem216 knockout zebrafish using CRISPR/Cas9 genome editing has proven effective for studying Tmem216 function . The methodological workflow includes:

  • Guide RNA Design and Synthesis

    • Target sequences specific to the tmem216 gene

    • Include appropriate promoter sequences for transcription

  • Microinjection

    • Injection of guide RNAs and Cas9 protein into zebrafish embryos at one-cell stage

  • Founder Identification

    • PCR genotyping of F0 zebrafish

    • Selection of animals yielding shorter PCR bands than wildtype

  • Line Establishment

    • Crossing F0 zebrafish with wildtype fish to obtain F1 generation

    • PCR and sequencing verification of F1 zebrafish

    • Identification of specific mutations in shorter bands (compared to 577bp wildtype band)

  • Colony Maintenance

    • Collection of experimental data from F2 and F3 generations

For phenotypic characterization, a comprehensive approach combining multiple techniques is recommended:

  • Immunofluorescence staining for ciliary and photoreceptor markers

  • Terminal deoxynucleotidyl transferase dUTP nick-end labeling (TUNEL) for cell death assessment

  • Electron microscopy for ultrastructural analysis

  • Western blotting for protein expression quantification

  • In situ hybridization for expression pattern analysis

Alternative approaches include siRNA knockdown in cell culture systems, which has been successfully employed to study TMEM216 function in fibroblasts .

How can researchers quantify structural and functional defects in Tmem216 mutant models?

Based on published methodologies, researchers should implement a multi-modal approach to comprehensively characterize Tmem216 mutant phenotypes:

  • Photoreceptor Morphology Assessment

    • Immunofluorescence staining with specific markers:

      • Rod photoreceptor outer segment: 4D2 antibody

      • Cone photoreceptor outer segment: G protein subunit α transducin 2 (GNAT2) antibody

      • Ciliary axoneme: acetylated α-tubulin antibody

  • Protein Localization Analysis

    • Evaluate outer segment protein distribution (rhodopsin, GNAT2, red opsin)

    • Quantify mislocalization to inappropriate cellular compartments

  • Cell Death Quantification

    • TUNEL staining to identify apoptotic nuclei

    • Calculation of TUNEL-positive cells as percentage of total cells in relevant layers

  • Ultrastructural Analysis

    • Electron microscopy to evaluate:

      • Outer segment disc morphology

      • Presence of vesicles/vacuoles within outer segments

      • Ciliary transition zone architecture

  • Protein Expression Quantification

    • Western blot analysis using:

      • Outer segment markers (e.g., GNAT2)

      • Normalization to housekeeping proteins (e.g., β-actin)

      • Band intensity quantification using software like ImageJ

These methodological approaches provide complementary data to thoroughly characterize the structural and functional consequences of Tmem216 mutation or deletion.

What are the genotype-phenotype correlations for different TMEM216 mutations?

Research has identified several important genotype-phenotype correlations for TMEM216 mutations:

  • Mutation Location and Protein Stability

    • All identified nonsynonymous changes occur in evolutionarily conserved residues

    • These mutations lead to unstable protein when expressed in heterologous cells

    • Both truncating mutations (in middle and end of protein) and specific missense mutations (particularly p.R73 transversions) are associated with disease

  • Founder Effects

    • The p.R73L mutation represents a clear founder mutation in the Ashkenazi Jewish population

  • Phenotypic Spectrum

    • Joubert Syndrome: Characterized by nephronophthisis (45%) and polydactyly (45%), without retinal dystrophy or congenital hepatic fibrosis

    • Oro-Facio-Digital type VI: Distinguished by polydactyly associated with either tongue tumors or multiple oral frenula

    • Meckel Syndrome: More severe presentation with skeletal dysplasia as a common feature

The specific mechanisms by which different mutations lead to distinct clinical presentations remain incompletely understood, highlighting the need for further research into structure-function relationships of the TMEM216 protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.