Recombinant Mouse Transmembrane protein 218 (Tmem218)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have a specific format requirement, please indicate it in your order notes. We will fulfill your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please contact your local distributor for specific delivery time information.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate with us beforehand. Additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default glycerol concentration is 50% and can be used as a reference.
Shelf Life
The shelf life of our proteins is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the intrinsic stability of the protein itself.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
If you have a specific tag type preference, please inform us, and we will prioritize its development.
Synonyms
Tmem218; Transmembrane protein 218
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-115
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Tmem218
Target Protein Sequence
MAGMVLGVGAGVFLLALIWVLVLLLCVLLSRASGIARFSIVFVFLGALIITTVLLLFPRA SEFPAPEGEMKIVDAFFIGRYVLLAFLSAVFLGGLFLLLTHHLLEPIYAKPLRSC
Uniprot No.

Target Background

Function
Tmem218 may be involved in ciliary biogenesis or function.
Gene References Into Functions
  1. tmem218-/- mice develop progressive cystic kidney disease and retinal degeneration, a model for Senior-Loken syndrome PMID: 25161209
Database Links
Protein Families
TMEM218 family
Subcellular Location
Membrane; Multi-pass membrane protein. Cell projection, cilium.

Q&A

What is Transmembrane Protein 218 (Tmem218) and what are its known functions?

Transmembrane Protein 218 (Tmem218) is a protein-coding gene that produces a membrane-spanning protein. It belongs to the broader family of transmembrane proteins that are integrated into biological membranes and play crucial roles in cell signaling, molecular transport, and maintaining cellular structure. While specific functions of Tmem218 are still being elucidated, transmembrane proteins generally serve as channels, receptors, enzymes, or structural components of the cell membrane. The research community is still characterizing the precise functions of Tmem218 in mouse models, with particular interest in its potential roles in development and disease processes .

How should recombinant Tmem218 be stored and handled for optimal stability?

Based on protocols for similar transmembrane proteins, recombinant Tmem218 should be stored in a manual defrost freezer to avoid repeated freeze-thaw cycles that can compromise protein integrity. Upon receipt, the lyophilized protein should be stored at -20°C to -80°C. For reconstitution, use sterile PBS or a buffer recommended by the manufacturer to a concentration of approximately 100 μg/mL. Once reconstituted, small working aliquots should be prepared to minimize freeze-thaw cycles, and the protein should be used within 1-2 months when stored at -20°C .

What expression systems are commonly used for producing recombinant mouse Tmem218?

For transmembrane proteins like Tmem218, mammalian expression systems such as HEK293 or CHO cells are preferred to ensure proper post-translational modifications and folding. These systems provide the cellular machinery necessary for correct membrane protein insertion and modification. Alternative systems include baculovirus-infected insect cells, which can produce higher yields while maintaining most post-translational modifications. For functional studies, it's critical to select an expression system that maintains the native conformation and biological activity of the transmembrane protein .

How should I design experiments to investigate Tmem218 function in vitro?

When designing experiments to investigate Tmem218 function:

  • Begin with clear hypothesis formulation about the protein's potential roles

  • Define your variables carefully:

    • Independent variable: Experimental conditions manipulating Tmem218 (e.g., overexpression, knockdown, site-directed mutations)

    • Dependent variable: Measured outcomes (e.g., cellular localization, protein interactions, signaling pathway activation)

    • Control variables: Cell type, culture conditions, transfection efficiency

  • Include appropriate controls:

    • Negative controls (empty vector, non-targeting siRNA)

    • Positive controls (well-characterized proteins with similar functions)

    • Vehicle controls for any chemical treatments

  • Consider cell line selection based on endogenous Tmem218 expression levels and relevance to your research question .

For functional studies, consider utilizing techniques such as co-immunoprecipitation to identify binding partners, subcellular fractionation to determine localization, and reporter assays to assess signaling pathway involvement.

What are the key considerations for designing knockout/knockdown studies for Tmem218?

When designing knockout or knockdown studies:

  • Select appropriate gene-editing approach:

    • CRISPR/Cas9 for complete gene knockout

    • siRNA or shRNA for temporary knockdown

    • Conditional knockouts for temporal or tissue-specific studies

  • Design targeting strategies:

    • For CRISPR, design at least 3-4 guide RNAs targeting different exons

    • For RNAi, design multiple siRNAs targeting different regions of the mRNA

  • Validation methods:

    • Genomic PCR and sequencing for CRISPR edits

    • qRT-PCR for mRNA expression levels

    • Western blotting for protein expression

  • Phenotypic analysis:

    • Begin with broad phenotypic assessments

    • Follow with targeted assays based on predicted functions

  • Consider compensatory mechanisms that may mask phenotypes .

Large-scale phenotyping campaigns like the International Mouse Phenotyping Consortium (IMPC) have demonstrated that systematic phenotypic analysis of knockouts can reveal unexpected functions and disease associations for previously uncharacterized genes .

How can I assess the interaction of Tmem218 with other membrane proteins?

To assess protein-protein interactions involving Tmem218:

  • Proximity Ligation Assay (PLA):

    • Allows visualization of endogenous protein interactions in situ

    • Provides spatial information about interaction sites within cells

    • Requires high-quality antibodies against both Tmem218 and potential interacting partners

  • FRET/BRET approaches:

    • Tag Tmem218 and potential partners with appropriate fluorophores

    • Measure energy transfer as indication of close proximity

    • Controls must include non-interacting membrane proteins with similar topology

  • Membrane-specific yeast two-hybrid systems:

    • Specialized for membrane protein interactions

    • Use split-ubiquitin system rather than traditional nuclear-based systems

    • Include appropriate topology controls

  • Co-immunoprecipitation with membrane-specific solubilization:

    • Use detergents optimized for transmembrane protein solubilization

    • Consider crosslinking prior to lysis

    • Implement stringent washing conditions to reduce false positives

What strategies are recommended for studying Tmem218 localization and trafficking?

For subcellular localization and trafficking studies:

  • Fluorescent protein fusions:

    • Create N- and C-terminal fusions to determine which orientation preserves function

    • Validate localization with endogenous protein by immunofluorescence

    • Use live-cell imaging to track dynamic movements

  • Domain mapping:

    • Create truncation mutants to identify localization signals

    • Mutate potential sorting motifs in the cytoplasmic domains

    • Assess changes in steady-state localization and trafficking kinetics

  • Pulse-chase experiments:

    • Use photo-activatable fluorescent proteins

    • Track protein movement through cellular compartments over time

    • Quantify rates of transport between compartments

  • Co-localization studies:

    • Use established markers for cellular compartments

    • Perform super-resolution microscopy for precise spatial relationships

    • Include Pearson's correlation coefficient analysis for quantitative assessment

How can contradictory data about Tmem218 function be reconciled in research?

When facing contradictory data about Tmem218 function:

  • Systematic analysis of experimental variables:

    • Create a comparison table of methodologies used in different studies

    • Identify key differences in experimental conditions, cell types, and reagents

    • Design experiments that directly test whether these variables explain discrepancies

  • Cell type-specific effects:

    • Assess Tmem218 expression levels across different cell types

    • Test function in multiple cell backgrounds

    • Consider tissue-specific binding partners that may alter function

  • Isoform-specific functions:

    • Analyze whether different splice variants were studied

    • Perform isoform-specific knockdown/rescue experiments

    • Characterize potential differences in interaction partners between isoforms

  • Replication studies:

    • Use multiple complementary techniques to verify key findings

    • Collaborate with laboratories reporting contradictory results

    • Share reagents and protocols to ensure methodological consistency

What purification strategies work best for recombinant transmembrane proteins like Tmem218?

For optimal purification of recombinant transmembrane proteins:

  • Solubilization optimization:

    Detergent TypeAdvantagesDisadvantagesBest Applications
    DDMGentle, maintains functionLower efficiencyFunctional studies
    CHAPSGood for preserving interactionsModerate solubilizationCo-IP experiments
    SDSHigh efficiencyDenaturingWestern blot analysis
    DigitoninPreserves protein complexesExpensiveComplex isolation
  • Affinity tag selection:

    • Choose tags that don't interfere with transmembrane domains

    • C-terminal tags often work better than N-terminal for transmembrane proteins

    • Consider dual tagging strategies for improved purity

  • On-column refolding:

    • Immobilize protein via affinity tag

    • Gradually remove denaturant through controlled buffer exchange

    • Add lipids or detergent micelles to facilitate proper folding

  • Quality control assessments:

    • Circular dichroism to verify secondary structure

    • Size exclusion chromatography to assess aggregation state

    • Functional assays specific to transmembrane protein class

What are the critical factors in designing accurate functional assays for Tmem218?

When designing functional assays for Tmem218:

  • Establish physiological relevance:

    • Determine endogenous expression patterns

    • Identify cell types with highest expression

    • Design assays that reflect native cellular environment

  • Consider membrane microenvironment:

    • Assess lipid composition effects on function

    • Test function in artificial membrane systems

    • Evaluate cholesterol dependence

  • Signal detection optimization:

    • Select detection methods with appropriate sensitivity

    • Establish signal-to-noise ratios for each assay

    • Develop positive controls with similar expected signal intensity

  • Temporal considerations:

    • Determine appropriate time points for measurements

    • Consider acute vs. chronic effects

    • Establish kinetic parameters when applicable

  • Validation across systems:

    • Compare results between overexpression and endogenous systems

    • Validate in multiple cell types

    • Confirm in vivo relevance when possible

How can I identify phenotypes associated with Tmem218 mutations in mouse models?

For comprehensive phenotypic analysis of Tmem218 mouse models:

  • Systematic pipeline approach:

    • Begin with broad phenotyping across major physiological systems

    • Follow standardized protocols similar to IMPC methodologies

    • Progress to targeted assays based on initial findings

  • Developmental analysis:

    • Track embryonic development using time-series imaging

    • Perform histological examination at key developmental stages

    • Assess viability and fertility of homozygous mutants

  • Tissue-specific assessment:

    Tissue/SystemRecommended AssaysParameters to Measure
    NeurologicalBehavioral testingMotor coordination, learning
    CardiovascularElectrocardiographyHeart rate, rhythm abnormalities
    ImmuneFlow cytometryLeukocyte populations, activation
    MetabolicGlucose toleranceBlood glucose, insulin response
    RenalUrine analysisProtein content, electrolytes
  • Molecular phenotyping:

    • Transcriptomics to identify dysregulated pathways

    • Proteomics to assess changes in protein expression

    • Metabolomics to evaluate metabolic alterations

  • Challenge models:

    • Expose mutants to stressors or disease models

    • Assess response differences compared to wild-type

    • Consider age-dependent phenotypes that may emerge later in life

How should I approach investigating potential disease associations of Tmem218?

To investigate disease associations:

  • Human genetic correlation:

    • Search for human TMEM218 variants in disease databases

    • Analyze GWAS studies for associations

    • Assess expression changes in patient samples

  • Pathway analysis:

    • Identify signaling pathways involving Tmem218

    • Look for overlap with known disease mechanisms

    • Perform network analysis with established disease genes

  • Functional validation:

    • Create mouse models with human disease-associated variants

    • Compare phenotypes to human disease presentations

    • Test therapeutic interventions that target relevant pathways

  • Translational approach:

    • Establish cellular models using patient-derived cells

    • Compare findings between mouse models and human cells

    • Validate key findings in additional model systems

The experience from large-scale mouse phenotyping projects has shown that unbiased phenotypic analysis of gene function can predict human disease associations before they are clinically recognized, as demonstrated for 29 genes in the Lexicon Pharmaceuticals' Genome5000 campaign .

What emerging technologies are most promising for studying transmembrane proteins like Tmem218?

Cutting-edge technologies for transmembrane protein research:

  • Cryo-electron microscopy:

    • Enables structural determination without crystallization

    • Allows visualization in native-like lipid environments

    • Can capture multiple conformational states

  • Organoid systems:

    • Study protein function in 3D tissue-like structures

    • Assess developmental roles in complex cellular organization

    • Evaluate function in physiologically relevant contexts

  • Single-molecule techniques:

    • TIRF microscopy for membrane protein dynamics

    • Single-particle tracking for diffusion analysis

    • Force measurements for structural transitions

  • Advanced genetic approaches:

    • Base editing for precise amino acid substitutions

    • Optogenetic control of protein activity

    • CRISPR screening for functional networks

  • Computational methods:

    • Molecular dynamics simulations of membrane integration

    • Machine learning for function prediction

    • Systems biology approaches to place in larger networks

How can I address the challenges of reproducibility in Tmem218 research?

To enhance reproducibility:

  • Detailed methodology documentation:

    • Provide complete information on cell lines, passage numbers

    • Document buffer compositions with exact pH values

    • Report temperature, incubation times, and equipment settings

  • Reagent validation and sharing:

    • Validate antibody specificity using knockout controls

    • Sequence verify all constructs and make them available

    • Use consistent sources for key reagents

  • Biological replication strategy:

    • Define appropriate sample sizes through power analysis

    • Use biological rather than technical replicates

    • Consider variation between different mouse strains or cell sources

  • Statistical approach:

    • Pre-determine statistical tests before data collection

    • Control for multiple comparisons

    • Report effect sizes alongside p-values

  • Data sharing:

    • Deposit raw data in appropriate repositories

    • Share detailed protocols on protocol sharing platforms

    • Consider pre-registration for key experiments

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.