Recombinant Mouse Transmembrane protein 220 (Tmem220)

Shipped with Ice Packs
In Stock

Description

Role in Hepatocellular Carcinoma (HCC)

Studies indicate that Tmem220 and its antisense RNA (TMEM220-AS1) are implicated in HCC progression:

  • Downregulation in HCC: TMEM220 mRNA levels are significantly reduced in HCC tissues compared to normal liver tissues, correlating with poor prognosis .

  • Tumor Suppression: Overexpression of TMEM220 in HCC cell lines (e.g., HB611, HuH-7) inhibits proliferation, metastasis, and epithelial-mesenchymal transition (EMT) by modulating pathways such as FOXO and PI3K-Akt .

    • Key Mechanisms:

      • Regulates β-catenin and FOXO3 subcellular localization, altering downstream targets like p21 and SNAIL .

      • Acts as a sponge for miR-484, upregulating tumor suppressor MAGI1 and inhibiting EMT markers (e.g., vimentin, Snail) .

In Vivo Validation

  • Xenograft models demonstrate that TMEM220 overexpression reduces tumor growth and pulmonary metastasis in nude mice .

Research Applications

Recombinant Mouse Tmem220 is employed in diverse experimental workflows:

ApplicationMethodOutcome
Protein InteractionRNA pull-down, RIP assaysIdentified binding partners (e.g., miR-484)
Cell ProliferationCCK-8, EdU assaysQuantified suppression of HCC cell growth
Apoptosis/Cell CycleFlow cytometryIncreased apoptosis and S-phase arrest in TMEM220-overexpressing cells
EMT AnalysisqRT-PCR, Western blotDownregulation of Snail/vimentin; upregulation of E-cadherin

Key Challenges and Considerations

  • Stability: Repeated freeze-thaw cycles degrade activity; single-use aliquots are recommended .

  • Species Specificity: Antibodies/ELISA kits for mouse Tmem220 may not cross-react with human homologs .

  • Functional Variability: Post-translational modifications (e.g., phosphorylation) differ between expression systems, impacting experimental outcomes .

Future Directions

  • Therapeutic Potential: TMEM220’s tumor-suppressive role in HCC highlights its potential as a biomarker or therapeutic target .

  • Mechanistic Studies: Further exploration of its interaction with signaling pathways (e.g., Wnt/β-catenin) could elucidate broader regulatory networks .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Tmem220; Transmembrane protein 220
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-167
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Tmem220
Target Protein Sequence
MAPAVATWAPGLWRACNALMAAFFALAAVVQVNDPDAELWVVVYMIPAVLTLLVGFNPLV TGNFIWKSVSAIHMLFCALWAGGLAYHFLLHAKQNLLNEEEGRELSGLVIVTAWMALCHS SSKNPGGGRMHLAIAVVITLLPLLSWVYVHMNKEMRSSWPTHCKTVI
Uniprot No.

Target Background

Database Links

KEGG: mmu:338369

UniGene: Mm.128138

Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is mouse Transmembrane Protein 220 (TMEM220) and what is known about its structure?

Mouse TMEM220 (transmembrane protein 220) is encoded by the Tmem220 gene (Gene ID: 338369) with its mRNA reference sequence documented as NM_177392.2 and protein reference sequence as NP_796366.1 . As a transmembrane protein, TMEM220 contains hydrophobic domains that span the cellular membrane. While the complete three-dimensional structure has not been fully characterized, transmembrane topology prediction suggests it contains multiple membrane-spanning regions typical of transmembrane proteins.

For researchers initiating studies on TMEM220, initial characterization should include:

  • Hydropathy plot analysis to confirm transmembrane domains

  • Protein sequence alignment with orthologs to identify conserved regions

  • Identification of potential functional motifs using bioinformatic tools

  • Expression profiling across tissue types to determine localization patterns

How should researchers approach TMEM220 expression analysis in mouse tissues?

For comprehensive expression profiling of TMEM220 in mouse tissues, researchers should employ multiple complementary approaches:

TechniqueApplicationResolutionLimitations
qRT-PCRQuantitative transcript measurementHigh sensitivityNo protein-level information
Western blottingProtein expression levelsGood for relative quantificationLimited spatial information
ImmunohistochemistrySpatial localizationCellular/subcellular localizationDepends on antibody specificity
RNA-seqTranscriptome-wide expressionComprehensive gene expressionNo protein-level information
Mass spectrometryProtein identificationDirect protein detectionComplex sample preparation

What expression systems yield optimal recombinant mouse TMEM220 protein quality?

When producing recombinant mouse TMEM220, the expression system significantly impacts protein quality, folding, and post-translational modifications. Based on production practices for transmembrane proteins:

Mammalian cell expression systems are generally preferred for mouse TMEM220 production as they provide the most native-like post-translational modifications and proper protein folding . HEK293 cells have been successfully used for recombinant production of transmembrane proteins similar to TMEM220. For research applications requiring high structural integrity, mammalian expression systems typically outperform bacterial systems despite lower yields.

Recommended protocol steps include:

  • Gene optimization for the selected expression system

  • Incorporation of a purification tag (commonly His-tag as used in commercial products)

  • Transient or stable transfection of expression constructs

  • Culture optimization to maximize protein yield while maintaining quality

  • Careful membrane protein extraction using mild detergents

  • Affinity purification followed by additional chromatography steps

What are the critical considerations for storage and handling of recombinant mouse TMEM220?

Proper storage and handling of recombinant TMEM220 is essential for maintaining biological activity. According to product information, researchers should:

  • Store the protein at +4°C for short-term use (days to weeks)

  • For long-term storage, maintain at -20°C to -80°C to prevent degradation

  • Use PBS buffer for storage, though specific applications may require buffer optimization

  • Consider adding stabilizers such as glycerol (typically 10-25%) for freeze-thaw protection

  • Minimize freeze-thaw cycles, as these can significantly decrease activity

  • When working with the protein, keep samples on ice and use within the recommended time frame

For experiments requiring repeated use, aliquoting into single-use volumes prior to freezing is strongly recommended to preserve protein integrity.

How can recombinant mouse TMEM220 be effectively used in protein interaction studies?

To identify TMEM220-interacting proteins and characterize these interactions, researchers should employ multiple complementary techniques:

  • Co-immunoprecipitation (Co-IP):

    • Use anti-TMEM220 antibodies or antibodies against the fusion tag (e.g., His-tag)

    • Confirm results with reverse Co-IP using antibodies against suspected binding partners

    • Include appropriate controls to rule out non-specific binding

  • Pull-down assays:
    Similar to the RNA pull-down assays described for TMEM220-AS1 , protein pull-down assays can be performed:

    • Immobilize purified recombinant TMEM220 on an appropriate matrix

    • Incubate with cell lysates or purified candidate interacting proteins

    • Elute and analyze bound proteins by mass spectrometry or western blotting

  • Proximity labeling methods:

    • Fusion of TMEM220 with BioID or APEX2 enables labeling of proximal proteins in living cells

    • This approach is particularly valuable for studying transmembrane protein interactions

  • Surface Plasmon Resonance (SPR) or Bio-Layer Interferometry (BLI):

    • For direct binding kinetics analysis between TMEM220 and purified interaction partners

    • Provides quantitative binding parameters (Kd, kon, koff)

When performing these studies, it is important to consider that transmembrane proteins often require proper membrane context or detergent solubilization for maintaining native interactions.

What analytical methods are most effective for characterizing recombinant mouse TMEM220 purity and integrity?

To ensure experimental reproducibility, thorough quality control of recombinant TMEM220 preparations is essential:

Analytical MethodParameter AssessedBenefitsConsiderations
SDS-PAGEPurity, molecular weightSimple, accessibleLimited resolution
Western blottingIdentity confirmationSpecific detectionRequires reliable antibodies
Size exclusion chromatographyAggregation statusNative conditions possibleLow resolution for similar-sized contaminants
Mass spectrometryExact mass, modificationsHigh resolution, can identify PTMsRequires specialized equipment
Circular dichroismSecondary structureValidates proper foldingLimited structural information
Endotoxin testingContaminationCritical for cell-based assaysLAL method commonly used

Commercial recombinant TMEM220 typically has purity >80% as determined by SDS-PAGE , but researchers may need higher purity for specific applications. For functional studies, endotoxin levels should be <1.0 EU per μg protein .

What is known about the relationship between TMEM220 and TMEM220-AS1 in cancer biology?

TMEM220-AS1 is a long non-coding RNA that has been implicated in hepatocellular carcinoma (HCC). Research findings indicate:

  • TMEM220-AS1 is significantly downregulated in hepatocellular carcinoma tissues compared to normal tissues

  • Low expression of TMEM220-AS1 correlates with promotion of malignant phenotypes in HCC cells

  • TMEM220-AS1 functions as an miRNA sponge that binds miR-484, thereby regulating the expression of membrane-associated guanylate kinase, WW, and PDZ domain containing 1 (MAGI1)

  • The TMEM220-AS1/miR-484/MAGI1 axis appears to play a tumor-suppressive role in HCC

While these findings focus on TMEM220-AS1 rather than TMEM220 protein itself, they suggest potential regulatory relationships that may implicate TMEM220 in cancer-related pathways. Further research is needed to determine whether:

  • TMEM220-AS1 directly regulates TMEM220 expression

  • TMEM220 protein levels correlate with TMEM220-AS1 expression in cancer tissues

  • TMEM220 protein has tumor-suppressive functions similar to TMEM220-AS1

How should researchers design experiments to investigate TMEM220 function in mouse disease models?

When investigating TMEM220 function in disease contexts, researchers should consider:

In vitro approaches:

  • Overexpression and knockdown studies in relevant cell lines (as performed for TMEM220-AS1 in HCC cells)

  • Assessment of cellular phenotypes including proliferation (using CCK-8 or EdU assays), apoptosis (flow cytometry), and invasion (Transwell assays)

  • Analysis of molecular pathway activation using western blotting or other protein detection methods

In vivo approaches:

  • Generation of TMEM220 knockout or conditional knockout mouse models

  • Xenograft models using cells with modified TMEM220 expression (similar to those used for TMEM220-AS1 studies)

  • Tissue-specific overexpression or knockdown in relevant disease models

Key readouts to assess:

  • Tumor growth parameters (volume, weight) in cancer models

  • Metastatic potential assessment (e.g., lung metastasis models)

  • Molecular markers of disease progression (e.g., EMT markers like E-cadherin, vimentin, and Snail)

  • Immunohistochemical analysis of proliferation markers (e.g., Ki-67)

Based on the TMEM220-AS1 research, initial disease focus areas might include hepatocellular carcinoma or other cancer types where transmembrane proteins play significant roles.

What approaches can identify and characterize post-translational modifications of TMEM220?

Post-translational modifications (PTMs) often regulate transmembrane protein function. For TMEM220 PTM analysis:

  • Mass spectrometry-based approaches:

    • Proteolytic digestion followed by LC-MS/MS analysis

    • Enrichment strategies for specific modifications (e.g., phosphopeptide enrichment)

    • Top-down proteomics for intact protein analysis

    • Site-directed mutagenesis to confirm functional PTM sites

  • Specific modification detection:

    • Phosphorylation: Phospho-specific antibodies, Phos-tag SDS-PAGE

    • Glycosylation: Lectin blotting, glycosidase treatments, mass shift analysis

    • Ubiquitination: Immunoprecipitation under denaturing conditions

  • Functional impact assessment:

    • Site-directed mutagenesis of predicted modification sites

    • Comparison of wild-type vs. mutant protein localization and function

    • Pharmacological inhibition of modifying enzymes

  • Computational prediction:

    • Use of PTM prediction algorithms as starting points for experimental validation

    • Structural modeling to assess accessibility of potential modification sites

For recombinant TMEM220 produced in mammalian cells, researchers should note that the pattern of modifications may differ from the native protein, particularly when using tagged constructs .

What are the methodological considerations for studying TMEM220 membrane topology and localization?

Understanding the membrane topology and subcellular localization of TMEM220 is crucial for elucidating its function:

Membrane topology analysis:

  • Protease protection assays: Limited proteolysis of intact cells vs. permeabilized cells

  • Fluorescence-based approaches: GFP/RFP tagging at different positions

  • Cysteine accessibility methods: SCAM (substituted cysteine accessibility method)

  • Epitope insertion with domain-specific antibody detection

Subcellular localization studies:

  • Immunofluorescence microscopy with organelle-specific markers

  • Subcellular fractionation followed by western blotting

  • Live-cell imaging with fluorescently tagged TMEM220

  • Super-resolution microscopy for detailed localization

Dynamic localization assessment:

  • Photoactivatable or photoconvertible fusion proteins

  • FRAP (fluorescence recovery after photobleaching) for mobility measurements

  • Stimulus-dependent trafficking assays

When designing topology experiments, researchers should consider that adding tags may affect protein folding or trafficking. Using small epitope tags and confirming results with multiple approaches is recommended for reliable topology mapping.

How can researchers overcome common challenges in generating functional antibodies against mouse TMEM220?

Developing specific antibodies against transmembrane proteins presents several challenges:

  • Antigen design strategies:

    • Focus on extracellular loops or domains rather than transmembrane regions

    • Use peptide antigens from hydrophilic regions

    • Consider recombinant protein fragments expressed in E. coli

    • For monoclonal antibody development, use DNA immunization approaches

  • Validation requirements:

    • Test antibody specificity using TMEM220 knockout or knockdown controls

    • Compare multiple antibodies targeting different epitopes

    • Perform peptide competition assays to confirm specificity

    • Validate across multiple applications (WB, IHC, IP, etc.)

  • Application-specific considerations:

    • For immunoprecipitation: optimize detergent conditions to maintain epitope accessibility

    • For immunohistochemistry: test multiple antigen retrieval methods

    • For flow cytometry: ensure antibodies recognize native (non-denatured) epitopes

If commercial antibodies are unavailable or unsuitable, custom antibody generation services can develop application-specific antibodies using the strategies above.

What are the critical factors affecting recombinant TMEM220 stability and activity in experimental systems?

To maintain optimal TMEM220 stability and functional activity:

  • Buffer composition considerations:

    • pH optimization (typically pH 7.2-7.4 for physiological relevance)

    • Salt concentration (physiological ionic strength usually preferred)

    • Addition of stabilizing agents (glycerol, specific detergents, etc.)

    • Protease inhibitor cocktails to prevent degradation

  • Storage conditions:

    • For short-term storage: 4°C in appropriate buffer

    • For long-term storage: -20°C to -80°C with cryoprotectants

    • Aliquoting to minimize freeze-thaw cycles

  • Detergent considerations for transmembrane proteins:

    • Selection of detergent type based on experimental goals

    • Critical micelle concentration (CMC) maintenance

    • Detergent exchange procedures for different applications

  • Experimental timing:

    • Perform critical experiments with freshly prepared protein when possible

    • Establish stability timelines through activity assays over different time points

    • Consider accelerated stability testing to predict long-term stability

Researchers should validate each new lot of recombinant TMEM220 before use in critical experiments, as production variables can affect protein quality and activity.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.