Recombinant Mouse Transmembrane protein 221 (Tmem221)

Shipped with Ice Packs
In Stock

Description

Production and Purification

Recombinant Mouse TMEM221 is synthesized using advanced CFPS platforms, enabling rapid production without cell culture. Key steps include:

  • Expression: Optimized codon usage in Nicotiana tabacum systems .

  • Purification: One-step affinity chromatography via Strep Tag, achieving >70–80% purity (validated by SDS-PAGE and HPLC) .

  • Quality Control: Concentration determined by absorbance at 280 nm, with validation via Western blot (WB) and ELISA .

Research Applications

Recombinant TMEM221 is utilized in:

4.1. Antibody Validation

  • Serves as a control protein for blocking experiments in WB, IHC, and ELISA .

  • Example: PA5-59636 antibody validation requires a 100x molar excess of recombinant TMEM221 .

4.2. Disease Modeling

  • Potential biomarker studies in cancer (e.g., lymphoma, ovarian cancer) due to its downregulation in malignancies .

  • Role in BMP signaling pathways, which are dysregulated in fibrosis and metastasis .

Challenges and Future Directions

  • Functional Gaps: The protein’s exact role in cellular pathways remains uncharacterized.

  • Species Variability: Limited cross-reactivity data between mouse and human orthologs .

  • Therapeutic Potential: CRISPR-Cas9 tools (e.g., AAV vectors ) could enable Tmem221 knockout studies to elucidate its contributions to diseases like pancreatic cancer .

Key Citations

  1. TMEM221 gene structure and expression profiles .

  2. Recombinant protein production and validation protocols .

  3. Commercial availability in disease research .

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, kindly include them in your order remarks. We will fulfill your request based on availability.
Lead Time
Delivery times may vary depending on the purchasing method and location. Please consult your local distributor for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal preservation, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure all contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can serve as a reference for your own preparation.
Shelf Life
Shelf life is influenced by various factors such as storage conditions, buffer components, temperature, and the intrinsic stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. For lyophilized form, the shelf life is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. For multiple uses, aliquoting is recommended. To ensure optimal quality, avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
Tag type is determined during production. If you have specific tag type requirements, please inform us and we will prioritize developing your specified tag type based on feasibility.
Synonyms
Tmem221; Transmembrane protein 221
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-230
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Tmem221
Target Protein Sequence
MGRSYGGRVLAAMTLLGIPAAVLVALAAQLLFQLQAGRAELRRVRTDGLHPELDPDAGLP EAAAGALLPLATALAALAQVLGLSCLLLAALCGHLGAELARGPGPGRSDWFLYDCRLLRH SALGLFCCGVSVYLAALAIYALLLFEIEAGAAAASILGSGALILVAIMTHTLFRAVQATR RGLRELSPPSFEDEPARPSEDSKSGCRAQPPQDEETETPIGAVTHQGSHF
Uniprot No.

Target Background

Database Links

KEGG: mmu:434325

UniGene: Mm.33613

Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What expression systems are available for recombinant Mouse Tmem221?

Recombinant Mouse Tmem221 can be produced using different expression systems, each with specific advantages for research applications:

Expression SystemVector ExampleTagApplications
Mammalian (HEK-293)Custom expression vectorsHis tagStructural/functional studies requiring proper folding and PTMs
BacterialpPB-N-His with T7 promoterHis tagHigh-yield protein production, in vitro assays

The mammalian expression system is particularly valuable for membrane proteins like Tmem221 as it provides proper folding machinery and post-translational modifications crucial for maintaining the protein's native conformation and functionality .

How can researchers validate the purity of recombinant Mouse Tmem221?

Multiple analytical techniques should be employed to confirm the purity of recombinant Mouse Tmem221:

  • Bis-Tris PAGE for molecular weight confirmation and initial purity assessment

  • Anti-tag ELISA for quantification of tagged protein

  • Western blot analysis using specific antibodies

  • Analytical SEC (HPLC) for homogeneity assessment

A high-quality recombinant preparation should demonstrate >90% purity across these analytical methods . For membrane proteins like Tmem221, it's particularly important to evaluate both protein purity and proper folding to ensure biological activity.

What are the optimal solubilization and purification strategies for Mouse Tmem221?

Purifying membrane proteins like Tmem221 requires specialized approaches:

  • Initial extraction: For mammalian-expressed Tmem221, one-step affinity chromatography using the His tag provides efficient initial purification .

  • Buffer optimization: Testing multiple detergents (e.g., DDM, LMNG, or GDN) at concentrations above their critical micelle concentrations is recommended to identify conditions that maintain protein stability while providing sufficient solubilization.

  • Purification refinement: After initial His-tag purification, size-exclusion chromatography can be employed to separate monomeric protein from aggregates and remove contaminating proteins.

  • Quality control: Circular dichroism spectroscopy can confirm proper secondary structure, which is critical for membrane proteins like Tmem221.

The optimization of these conditions should be performed iteratively, with functional assays guiding the selection of conditions that preserve biological activity.

How do expression conditions affect the yield and quality of recombinant Mouse Tmem221?

Expression conditions significantly impact both yield and quality of recombinant Mouse Tmem221:

ParameterMammalian ExpressionBacterial Expression
Temperature37°C (growth), 30-32°C (induction)37°C (growth), 16-18°C (induction)
InductionConstitutive or inducible promotersIPTG concentration (0.1-1.0 mM)
Duration48-72 hours post-transfection16-20 hours post-induction
Media supplementsSodium butyrate can enhance expressionRare codon supplementation

For mammalian expression, HEK-293 cells have been successfully used for Mouse Tmem221 production . The optimization of expression system ensures reliability for intracellular, secreted, and transmembrane proteins . When using bacterial expression systems with vectors like pPB-N-His, harvesting cells at appropriate times post-induction is critical .

What functional assays can characterize Mouse Tmem221 activity?

While specific functions of Mouse Tmem221 are still being elucidated, researchers can employ several approaches to characterize its activity:

  • Membrane localization studies: Immunofluorescence microscopy with tagged Tmem221 to confirm proper cellular localization.

  • Protein-protein interaction assays: Co-immunoprecipitation or proximity ligation assays to identify binding partners.

  • Functional reconstitution: Incorporation into liposomes or nanodiscs to study transport or signaling functions.

Studies of related transmembrane proteins like TMEM222 suggest potential neuronal functions, as TMEM222 localizes to early endosomes in synapses of mature neurons . Similar approaches could be applied to investigate whether Tmem221 shows comparable localization patterns or functional properties.

How does Mouse Tmem221 compare to other TMEM family proteins?

Comparative analysis of TMEM family proteins reveals important insights:

ProteinSizeKnown LocalizationAssociated Functions
Tmem221230 aaMembrane-associatedUnder investigation
TMEM222208 aaEarly endosomes in neuronal synapsesNeurodevelopmental processes

Research on TMEM222 has shown its importance in brain development and function, with biallelic variants causing neurodevelopmental disorders . While Tmem221's specific functions remain to be fully characterized, the methodologies applied to TMEM222 provide valuable frameworks for investigating Tmem221.

What considerations are important when designing knockout or knockdown studies for Mouse Tmem221?

When designing genetic manipulation studies for Mouse Tmem221:

  • Target specificity: Design guides or shRNAs with minimal off-target effects by validating against the entire mouse genome.

  • Knockout verification approaches:

    • Genomic PCR and sequencing to confirm modifications

    • Western blot analysis to verify protein depletion

    • RT-qPCR to assess mRNA levels

  • Phenotypic analysis: Based on insights from related proteins like TMEM222, examination of neuronal development, synapse formation, and endosomal trafficking may be particularly relevant .

  • Complementation studies: Rescue experiments using wild-type Mouse Tmem221 are essential to confirm that observed phenotypes are specifically due to Tmem221 loss rather than off-target effects.

What are the critical factors for studying Tmem221 protein-protein interactions?

When investigating protein-protein interactions of Mouse Tmem221:

  • Tag selection: While His tags are useful for purification , consider alternative or dual tagging strategies (FLAG, HA, etc.) for interaction studies to minimize steric hindrance.

  • Crosslinking approaches: Use membrane-permeable crosslinkers at optimized concentrations to capture transient interactions.

  • Proximity labeling: Techniques like BioID or APEX2 can identify proteins in the vicinity of Tmem221 within its native cellular environment.

  • Control experiments: Include proper controls such as tag-only constructs and non-relevant membrane proteins to distinguish specific from non-specific interactions.

  • Validation strategies: Confirm interactions using multiple independent techniques (co-IP, FRET, BiFC) under physiologically relevant conditions.

How can researchers optimize heterologous expression of Mouse Tmem221?

For successful heterologous expression of Mouse Tmem221:

  • Codon optimization: Adjust codon usage based on the expression host to enhance translation efficiency.

  • Signal sequence modifications: Consider testing different signal sequences to improve membrane targeting.

  • Expression vector selection: For mammalian expression, vectors with strong promoters like CMV have been successful . For bacterial expression, T7 promoter-based systems can be effective .

  • Cell line screening: Test multiple cell lines beyond HEK-293, such as CHO, COS-7, or Expi293 for mammalian expression to identify optimal hosts.

  • Expression monitoring: Implement real-time monitoring using reporter fusions or split GFP systems to track expression efficiency without disrupting protein function.

How can researchers address poor expression yields of Mouse Tmem221?

When facing low expression yields:

  • Expression system adjustment: If bacterial expression is unsuccessful, transition to the mammalian HEK-293 system that has been validated for Mouse Tmem221 .

  • Temperature modulation: Lower induction temperatures (16-18°C for bacteria, 30-32°C for mammalian cells) can improve folding of membrane proteins.

  • Additives and chaperones: Include chemical chaperones like glycerol or DMSO in culture media, or co-express molecular chaperones.

  • Fusion partners: Consider fusion with solubility-enhancing partners (MBP, SUMO, etc.) with appropriate cleavage sites.

  • Construct optimization: Generate truncated versions focusing on specific domains if the full-length protein (AA 1-230) proves challenging .

What strategies can overcome aggregation of purified Mouse Tmem221?

To address aggregation issues:

  • Detergent screening: Systematically test different detergents and concentrations to identify optimal solubilization conditions.

  • Buffer optimization: Adjust pH, salt concentration, and add stabilizing agents like glycerol or specific lipids.

  • Purification temperature: Maintain low temperatures (4°C) throughout the purification process.

  • Alternative solubilization approaches: Consider nanodiscs, amphipols, or SMALPs as alternatives to traditional detergent solubilization.

  • Analytical ultracentrifugation: Use to distinguish between monomeric, oligomeric, and aggregated states to guide optimization efforts.

What are promising approaches for structural characterization of Mouse Tmem221?

For structural studies of Mouse Tmem221:

  • Cryo-EM: Single-particle analysis of detergent-solubilized or nanodisc-incorporated Tmem221.

  • X-ray crystallography: Using advanced crystallization techniques for membrane proteins, including lipidic cubic phase methods.

  • NMR spectroscopy: Solution NMR of isolated domains or solid-state NMR of the full-length protein in a membrane environment.

  • Computational modeling: Leveraging AI-based structure prediction tools like AlphaFold2, with experimental validation.

The high-purity (>90%) recombinant Mouse Tmem221 produced in mammalian cells provides a strong starting point for these structural studies.

How might Mouse Tmem221 function compare with TMEM222's role in neurodevelopment?

Based on insights from TMEM222 research:

  • Functional conservation: Investigate whether Tmem221, like TMEM222, localizes to early endosomes in neuronal synapses .

  • Expression pattern analysis: Compare brain region-specific expression patterns of Tmem221 with the relatively high TMEM222 expression observed in human brain, especially in parietal and occipital cortex .

  • Knockout phenotypes: Compare neurological phenotypes between Tmem221 and TMEM222 knockouts to identify functional overlap or divergence.

  • Interaction partner comparison: Determine whether Tmem221 shares interaction partners with TMEM222, which could suggest conserved functional pathways.

Research on TMEM222's role in neurodevelopmental disorders provides valuable frameworks for investigating potential neurological functions of Tmem221 .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.