Recombinant Mouse Transmembrane protein 222 (Tmem222)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
The tag type will be determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Tmem222; D4Ertd196e; Transmembrane protein 222
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-208
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Tmem222
Target Protein Sequence
MAEAEGSSPLLLQPPPPPPRMAEVETPTGAETDMKQYHGSGGVVMDVERSRFPYCVVWTP IPVLTWFFPIIGHMGICTSAGVIRDFAGPYFVSEDNMAFGKPAKFWKLDPGQVYASGPNA WDTAVHDASEEYKHRMHNLCCDNCHSHVALALNLMRYNNSTNWNMVTLCCFCLIYGKYVS VGAFVKTWLPFVLLLGIILTVSLVFNLR
Uniprot No.

Target Background

Database Links
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is Mouse Transmembrane protein 222 (Tmem222) and how does it compare to human TMEM222?

Mouse Transmembrane protein 222 (Tmem222) is a 208-amino acid protein encoded by the Tmem222 gene. It contains three predicted transmembrane domains and a domain of unknown function (DUF778) . The protein shares 95% identity and 96% similarity with its human ortholog . Despite this high conservation, there may be subtle functional differences between species, particularly in tissue-specific expression patterns.

When studying Tmem222, researchers should consider these species-specific differences when extrapolating findings between mouse models and human studies. The high degree of conservation suggests evolutionary significance of this protein across mammals, with both mouse and human versions predicted to localize to secretory vesicles .

What cellular localization patterns does Tmem222 exhibit and how can these be visualized?

Tmem222 primarily localizes to early endosomes in synapses of mature neurons, as demonstrated in human iPSC-derived neurons . For visualization, researchers can employ:

  • Fluorescence microscopy techniques using antibodies against Tmem222

  • Transfection with fluorescently tagged Tmem222 constructs (C2-GFP-TMEM222)

  • Co-localization studies with endosomal markers

Methodologically, researchers should:

  • Use Gateway cloning systems to create expression constructs

  • Transfect neuronal cell lines using appropriate reagents like FuGene HD

  • Employ confocal microscopy for high-resolution imaging

  • Validate localization using subcellular fractionation followed by Western blotting

For optimized visualization, consider using HEK293T cells initially to establish protocols before moving to neuronal systems, as demonstrated in previous studies that verified Tmem222 expression using anti-TMEM222 antibodies (such as NBP2–49295 from Novus Biologicals) .

How is Tmem222 expression distributed across mouse tissues?

Tmem222 demonstrates a widespread but variable expression pattern across different tissues. While comprehensive mouse-specific expression data is limited, the human ortholog shows 3.8 times higher expression than the average gene in databases . Based on human data, highest expression levels are found in:

  • Brain tissue (particularly parietal and occipital cortex)

  • Lung, colon, kidney, and placenta

For researchers investigating tissue-specific expression:

  • Consider quantitative RT-PCR using tissue-specific RNA samples

  • Follow protocols similar to those used in human studies, which employed SuperScript VILO Master Mix for cDNA synthesis

  • Analyze using the ΔΔCt method on systems like ABI PRISM 7900HT

  • Validate findings with protein-level analysis using Western blotting

What expression systems are optimal for producing Recombinant Mouse Tmem222?

Multiple expression systems have been successfully used to produce Recombinant Mouse Tmem222, each with specific advantages:

Expression SystemTag OptionsBenefitsConsiderations
E. coliHisHigh yield, cost-effectiveMay lack post-translational modifications
HEK293 (mammalian cells)DDK, Myc, His, Avi, FcProper folding and modificationsLower yield, higher cost
Other mammalian cellsHisPhysiological modificationsSystem-specific optimization required

When selecting an expression system, consider:

  • Whether post-translational modifications are critical for your research

  • Required protein yield

  • Downstream applications (structural studies, functional assays)

  • Tag compatibility with experimental design

For studies focusing on neuronal function, mammalian expression systems are recommended as they provide proper protein folding and modifications that may be crucial for functionality .

What are effective strategies for purifying Recombinant Mouse Tmem222?

Purification strategies depend on the tags incorporated into your recombinant construct. Based on available recombinant proteins, recommended approaches include:

  • For His-tagged Tmem222:

    • Immobilized metal affinity chromatography (IMAC)

    • Buffer optimization to maintain membrane protein stability

    • Consider mild detergents to solubilize membrane domains

  • For DDK/Myc-tagged Tmem222:

    • Immunoaffinity chromatography

    • Anti-DDK or anti-Myc antibody columns

  • For Avi-Fc-His-tagged Tmem222:

    • Sequential purification using multiple tags

    • Protein A/G columns for Fc-tag purification followed by IMAC

When purifying transmembrane proteins like Tmem222, special consideration should be given to maintaining protein structure and function by including appropriate detergents in all buffers and optimizing salt concentrations to prevent aggregation .

How can researchers troubleshoot problems with Recombinant Mouse Tmem222 expression?

Common challenges in Tmem222 expression and troubleshooting approaches include:

  • Low expression levels:

    • Optimize codon usage for the expression system

    • Test different promoters for improved expression

    • Consider inducible expression systems for potentially toxic proteins

  • Protein insolubility/aggregation:

    • Modify lysis conditions with different detergents

    • Test expression at lower temperatures

    • Consider fusion partners that enhance solubility

  • Degradation:

    • Include protease inhibitors in all buffers

    • Reduce expression time

    • Analyze for potential proteolytic sites and modify accordingly

  • Non-functional protein:

    • Verify protein folding using circular dichroism

    • Test different tags and tag positions

    • Consider native purification conditions

When working with Tmem222, researchers should validate expression using Western blotting with antibodies against both the protein and the tag, as demonstrated in previous studies using anti-TMEM222 (1:2,000; catalog number NBP2–49295, Novus Biologicals) and anti-tubulin (1:2,000; catalog number T5326, Sigma Aldrich) for normalization .

What methodologies are effective for studying Tmem222's role in synaptic function?

Given Tmem222's localization to early endosomes in synapses, several approaches are recommended:

  • Electrophysiological recordings:

    • Patch-clamp recordings in Tmem222 knockout/knockdown neurons

    • Analysis of synaptic transmission parameters

    • Long-term potentiation/depression studies

  • High-resolution imaging:

    • Super-resolution microscopy to track Tmem222 dynamics

    • Live-cell imaging with fluorescently tagged Tmem222

    • FRAP (Fluorescence Recovery After Photobleaching) for mobility studies

  • Proteomic approaches:

    • Co-immunoprecipitation to identify interacting partners

    • Proximity labeling methods (BioID, APEX)

    • Quantitative proteomics comparing wild-type vs. mutant conditions

  • Functional assays:

    • Endosomal trafficking assays

    • Synaptic vesicle recycling analyses

    • Calcium imaging during neuronal activity

When designing these experiments, researchers should include appropriate controls and consider the developmental timing of Tmem222 expression, as its role may vary during different stages of neuronal maturation .

What is known about Tmem222 mutations and their impact on neurodevelopment?

While most research has focused on human TMEM222 mutations, these findings provide valuable insights for mouse studies:

Biallelic variants in human TMEM222 have been identified in 17 individuals from nine unrelated families, presenting with:

  • Intellectual disability (primary phenotype)

  • Aggressive behavior

  • Shy character

  • Body tremors

  • Decreased muscle mass in lower extremities

  • Mild hypotonia

For researchers studying mouse models:

  • Consider generating equivalent mutations in mouse Tmem222 using CRISPR/Cas9

  • Develop comprehensive behavioral testing protocols including:

    • Cognitive assessments (Morris water maze, novel object recognition)

    • Motor function evaluations (rotarod, grip strength)

    • Social interaction paradigms

  • Analyze neuronal morphology and synapse formation in mutant models

  • Evaluate endosomal trafficking in neurons derived from mutant mice

The high expression of Tmem222 in human brain, particularly in the parietal and occipital cortex, suggests focusing on these regions when studying neurodevelopmental impacts in mouse models .

How can protein-protein interactions of Tmem222 be effectively studied?

Given Tmem222's localization and potential role in neurodevelopment, several approaches are recommended for studying its interactions:

  • Co-immunoprecipitation (Co-IP):

    • Use anti-Tmem222 antibodies or antibodies against the tag in recombinant versions

    • Crosslinking may be necessary to capture transient interactions

    • Consider native vs. denaturing conditions depending on interaction stability

  • Proximity-based methods:

    • BioID fusion with Tmem222 to identify proximal proteins in living cells

    • APEX2 fusion for temporal control of proximity labeling

    • Split-GFP complementation for direct visualization of interactions

  • Yeast two-hybrid screening:

    • Consider membrane yeast two-hybrid systems for transmembrane proteins

    • Use soluble domains of Tmem222 as bait for conventional Y2H

  • Interactome analysis:

    • Mass spectrometry after Co-IP or proximity labeling

    • Compare interactomes in different neuronal states or developmental stages

    • Validate key interactions with multiple methods

When performing these studies, researchers should be aware that the transmembrane nature of Tmem222 may complicate certain interaction studies, necessitating optimization of detergent conditions to solubilize the protein while maintaining interaction potential .

How conserved is Tmem222 across species and what insights does this provide?

Tmem222 shows remarkable conservation across evolutionary diverse species, suggesting fundamental biological importance:

SpeciesCommon NameProtein LengthSimilarity to HumanIdentity to Human
Rattus norvegicusRat208aa99%96%
Canis familiarisDog208aa98%96%
Mus musculusMouse208aa96%95%
Sus scrofaPig208aa97%94%
Equus caballusHorse207aa94%93%
Gallus gallusChicken182aa90%85%
Danio rerioZebrafish174aa83%71%
Drosophila melanogasterFruit Fly196aa74%61%
Anopheles gambiaeMosquito197aa66%53%

This high conservation suggests:

  • Tmem222 likely serves a fundamental cellular function conserved through evolution

  • The protein's structure-function relationship is tightly constrained

  • Findings from mouse models may translate well to human applications

  • Invertebrate models could potentially be used for basic functional studies

Research approaches to leverage this conservation include:

  • Complementation studies across species

  • Domain swapping between orthologs to identify functional regions

  • Comparative analysis of expression patterns and interactomes across species

What functional differences exist between mouse and human TMEM222 orthologs?

Despite the high sequence similarity (95% identity) between mouse and human TMEM222, potential functional differences may exist:

  • Expression patterns:

    • While both show high brain expression, tissue-specific differences may exist

    • Developmental timing of expression may vary between species

  • Protein interactions:

    • Species-specific interaction partners may drive functional differences

    • Conserved interactions likely represent core functions

  • Post-translational modifications:

    • Different modification patterns may affect localization or function

    • Modified residues may vary between species despite sequence conservation

To investigate these differences:

  • Perform comparative expression profiling across tissues and developmental stages

  • Conduct parallel interaction studies in both species

  • Analyze post-translational modifications using mass spectrometry

  • Test functional complementation by expressing mouse Tmem222 in human cells with TMEM222 knockdown and vice versa

Understanding these nuances is critical when extrapolating findings from mouse models to human disease contexts, particularly for neurodevelopmental disorders linked to TMEM222 mutations .

How can Tmem222 knockout mice be generated and what phenotypes have been observed?

Generating Tmem222 knockout mice:

  • CRISPR/Cas9 approach:

    • Design guide RNAs targeting early exons of Tmem222

    • Screen for frameshift mutations that result in complete loss of protein

    • Validate knockout at mRNA and protein levels

  • Conditional knockout strategy:

    • Generate floxed Tmem222 alleles

    • Cross with tissue-specific or inducible Cre lines

    • Particularly valuable for studying neuronal functions while avoiding potential developmental lethality

  • Knockin reporter approach:

    • Replace Tmem222 coding sequence with a reporter (GFP/LacZ)

    • Enables tracking of cell populations normally expressing Tmem222

Based on human disease associations, expected phenotypes may include:

  • Neurodevelopmental abnormalities

  • Cognitive deficits

  • Behavioral changes (potentially including aggression)

  • Motor coordination issues

  • Muscle mass abnormalities, particularly in lower limbs

When analyzing these models, comprehensive phenotyping should include:

  • Behavioral testing batteries

  • Electrophysiological assessment of neuronal function

  • Histological analysis of brain development

  • Molecular characterization of endosomal trafficking

  • Synaptic protein composition analysis

What controls should be included when studying Tmem222 localization in neuronal cells?

When investigating Tmem222 localization in neurons, several controls are essential:

  • Antibody specificity controls:

    • Peptide competition assays

    • Parallel staining in Tmem222 knockout/knockdown cells

    • Multiple antibodies targeting different epitopes

  • Organelle markers for co-localization:

    • Early endosome markers (Rab5, EEA1)

    • Late endosome markers (Rab7)

    • Recycling endosome markers (Rab11)

    • Synaptic vesicle markers (Synaptophysin)

    • Post-synaptic markers (PSD-95)

  • Expression level controls:

    • Compare endogenous vs. overexpressed protein localization

    • Use inducible expression systems to control expression levels

    • Consider knockin approaches for physiological expression levels

  • Methodological controls:

    • Live vs. fixed cell imaging comparisons

    • Multiple fixation methods to rule out fixation artifacts

    • Super-resolution vs. conventional microscopy validation

Previous research has demonstrated Tmem222 localization to early endosomes in synapses of mature iPSC-derived neurons, suggesting a role in endosomal trafficking within the synapse. This finding should be validated in mouse neurons using similar methodological approaches .

What are promising research directions for understanding Tmem222 function in neuronal development?

Based on current knowledge, several promising research avenues include:

  • Endosomal trafficking role:

    • Investigate how Tmem222 influences receptor internalization and recycling

    • Examine effects on synapse formation and maintenance

    • Study potential roles in neuronal polarization and axon/dendrite development

  • Synaptic plasticity:

    • Analyze Tmem222's role in long-term potentiation and depression

    • Investigate activity-dependent regulation of Tmem222 expression or localization

    • Study effects of Tmem222 mutations on learning and memory

  • Interactome mapping:

    • Comprehensive identification of Tmem222 binding partners

    • Temporal analysis of interactions during development

    • Comparison of wild-type vs. disease-associated variant interactomes

  • Signaling pathway integration:

    • Investigate whether Tmem222 functions within known neurodevelopmental signaling pathways

    • Examine phosphorylation states and regulatory mechanisms

    • Study potential roles in growth factor receptor trafficking

  • Therapeutic targeting:

    • Screen for small molecules that modulate Tmem222 function

    • Explore gene therapy approaches for disease-associated variants

    • Develop biomarkers for Tmem222-associated pathologies

These research directions should be pursued using a combination of in vitro neuronal cultures, mouse models, and potentially organoid systems to comprehensively understand Tmem222's neuronal functions .

What are the key considerations for researchers beginning work with Recombinant Mouse Tmem222?

Researchers new to Tmem222 should consider:

  • Expression system selection:

    • Choose based on experimental needs and downstream applications

    • Consider HEK293 mammalian expression for neuronal studies

    • E. coli systems may be sufficient for structural analyses

  • Construct design:

    • Tag placement can significantly impact function

    • Consider the transmembrane topology when designing constructs

    • Include appropriate controls (empty vector, inactive mutants)

  • Validation strategies:

    • Confirm expression using Western blotting

    • Verify localization with immunofluorescence

    • Assess function with appropriate assays

  • Experimental controls:

    • Generate knockout/knockdown systems

    • Include wild-type controls in all experiments

    • Consider rescue experiments to confirm specificity

  • Translational relevance:

    • Connect findings to human disease contexts

    • Consider cross-species validation of key findings

    • Develop models that recapitulate human pathology

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.