Recombinant Mouse Transmembrane protein 223 (Tmem223)

Shipped with Ice Packs
In Stock

Description

Introduction

Transmembrane protein 223 (TMEM223) is a protein that interacts with the mitochondrial ribosome and functions in the biogenesis of cytochrome $$c$$ oxidase . It is an integral protein of the inner mitochondrial membrane (IMM) with its N- and C-termini facing the mitochondrial matrix .

3.1. Impact on Cytochrome $$c$$ Oxidase

Knockout studies utilizing CRISPR/Cas9 to target the TMEM223 gene have revealed that loss of TMEM223 results in a reduction of the late assembling complex IV subunit COX6A, while COX4-1 or the COX1 assembly factors C12ORF62 (COX14) and MITRAC12 (COA3) were not altered . Also, proteins of other OXPHOS complexes, such as NDUFA9 (complex I), SDHA (complex II), or ATP5B (complex V), remained unaffected . An increase of RIESKE, a core protein of complex III, has been observed . Cytochrome $$c$$ oxidase activity is reduced to 62.5% of wild-type (WT) in TMEM223−/− cells .

3.2. Role in Mitochondrial Translation

TMEM223 is required for translation of mitochondrial-encoded complex IV subunits . [35S]methionine labeling of mitochondrial translation products revealed a significant decrease in the levels of newly synthesized COX1 in TMEM223−/− cells compared to WT, while other mitochondrial-encoded proteins, including COX2 and COX3, displayed no differences . A comparable reduction of COX1 synthesis to 61.23% was observed using a [35S]methionine labeling approach in siRNA-mediated depleted TMEM223 cells .

3.3. Interactome Analysis

TMEM223 interacts with early .

TMEM223 and Apoptosis

Ectopic expression of wild-type (WT) and Parkinson’s disease (PD)-linked mutant TMEM230 variants in cultured cells dramatically induced apoptotic cell death compared with that of vector control cells . Mutant TMEM230 caused cell toxicity at an increased severity than WT TMEM230 . Expression of TMEM230 increased mitochondrial reactive oxygen species (ROS) levels, decreased cellular ATP, activated caspase 3/7, and increased poly(ADP-ribose) polymerase-1 (PARP1) cleavage . Treatment with N-acetylcysteine (NAC; an ROS scavenger) or Z-VAD-FMK (a caspase inhibitor) significantly attenuated TMEM230-induced apoptosis in both cultured cells and primary neurons . TMEM230 mediates a PARP1-linked apoptotic cell death pathway .

TMEM230 in Angiogenesis and Tumor Therapy

TMEM230 promotes aspects of angiogenesis in parallel or independently of the Delta/Notch and VEGF signaling pathways and has the properties of being a novel master regulator in angiogenesis . Precise regulated levels of TMEM230 expression may determine its role in normal or disease-associated angiogenesis . TMEM230 is expressed in human tumors and may represent a promising novel drug target for antiangiogenic or antitumor therapy to restrict GBM tumor cell properties and tumor cell-promoted angiogenesis .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type will be determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Tmem223; Transmembrane protein 223
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-199
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Tmem223
Target Protein Sequence
MVASVPLRNVSHLLSVLRSQNVPRYLQNGVPRDVLLFRHERGRFFAILGLFCAGQGIFWT SLAVAALSRPLSRVPAEAPNRSYQDLRSALWRYGLAVGCGTMGVLVLGAGLLYSLRSVRS VMLLAGGQQVTLTTYAPFGLGTCFTVPLNQISCMAHRGEVPAMLPLKVKGRRFYFLLDKA GHFPNTQLFDNTVGAYRSL
Uniprot No.

Target Background

Database Links
Protein Families
TMEM223 family
Subcellular Location
Membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.