Recombinant Mouse Transmembrane protein 225 (Tmem225)

Shipped with Ice Packs
In Stock

Description

Definition and Production

Recombinant Mouse TMEM225 is a partial-length protein (UniProt ID: Q9D9S2) expressed in Escherichia coli using codon-optimized DNA sequences. Key production details include:

ParameterSpecification
Product CodeCSB-EP023820MO1
Expression SystemE. coli
Purity>85% (verified by SDS-PAGE)
StorageLyophilized form: 12 months at -20°C/-80°C; reconstituted: 6 months at -20°C/-80°C
ReconstitutionDeionized sterile water (0.1–1.0 mg/mL), with optional 50% glycerol for stability

This recombinant protein lacks post-translational modifications and is primarily used in antibody generation, protein interaction studies, and functional assays .

Functional Insights from Knockout Models

Studies using Tmem225 knockout (KO) mice revealed its critical role in sperm maturation and fertility:

Phenotypic Effects

  • Infertility: KO males are infertile despite normal spermatogenesis .

  • Sperm Defects:

    • Reduced motility due to impaired epididymal maturation.

    • Flagellar folding (hairpin-loop configuration) .

    • Elevated reactive oxygen species (ROS) and compromised mitochondrial function .

Proteomic Alterations

KO sperm showed dysregulation in pathways critical for sperm function:

PathwayImpact
GlycolysisReduced ATP production, affecting motility
Mitochondrial FunctionImpaired oxidative phosphorylation and ROS scavenging
Flagellar MorphologyDisrupted axonemal structure and bending capacity

These defects suggest TMEM225 regulates protein trafficking or stability during sperm maturation .

Research Applications

Recombinant TMEM225 facilitates:

  • Antibody Development: Used to generate antibodies for detecting endogenous TMEM225 in testicular tissues .

  • Mechanistic Studies: Investigating its interaction with protein phosphatase 1 (PP1) via PPP1CC binding, which modulates sperm capacitation .

  • Diagnostic Tools: Evaluating TMEM225 expression in urinary cell pellets as a biomarker for bladder cancer .

Future Directions

Current research gaps include:

  • Structural Resolution: Full-length protein crystallization to map interaction sites.

  • Therapeutic Targets: Exploring TMEM225 modulation to treat asthenospermia or male infertility .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. For specific delivery times, please consult your local distributors.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please contact us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by factors such as storage conditions, buffer composition, temperature, and protein stability.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type requirement, please inform us and we will prioritize developing it accordingly.
Synonyms
Tmem225; Pmp22cd; Transmembrane protein 225
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-230
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Tmem225
Target Protein Sequence
MMHIPNRSIQAANIFFSSGAILLLIVGLIMEDWVELIPKVRKDKTTHSPWLGCCPPFWPE ESLEVVRRIMRMTLNISIYLNLIIGLQFSYMISQNKCVHLLVGFLSFFAGCLLFYAIIVY HHKLNKGQYVYFVNYKTKWIAFTVYLTIALFLTCGIFCFIQSTNRCECMKFCIPHTESKS QEMIPSTIEVVSLPPRCAMPRSIVHVHSVTSKDGSLNRPHTQARRVTWAL
Uniprot No.

Target Background

Function
Tmem225 is likely to inhibit protein phosphatase 1 (PP1) in sperm by binding to the catalytic subunit PPP1CC.
Gene References Into Functions
  1. TMEM225 plays a role in sperm differentiation and function by regulating the activity of PP1gamma2. PMID: 25605614
Database Links
Subcellular Location
Cytoplasmic vesicle, secretory vesicle, acrosome membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in testis, epididymis and spermatozoa (at protein level). Not expressed in brain, heart, lung, liver, spleen, kidney and skeletal muscle.

Q&A

What is the basic structure of mouse TMEM225 protein?

TMEM225 is a four-transmembrane domain protein containing an RVxF motif, which serves as a consensus binding site for serine/threonine protein phosphatase 1 (PP1). The protein is encoded by the Tmem225 gene with an open reading frame of approximately 696 bp. In mice, TMEM225 is a testis-specific protein that plays a critical role in male fertility. The protein structure includes four putative transmembrane helices, with the carboxy-terminal region being particularly important for its interaction with PP1γ2 .

What is the expression pattern of TMEM225 in mouse tissues?

TMEM225 expression is highly specific to testicular germ cells, with expression levels increasing during spermatogenesis. The protein is not detected in other tissues, making it a truly testis-specific protein. In mature spermatozoa, TMEM225 is precisely localized to the equatorial segment of the acrosome but is absent from the midpiece and tail regions. Following the acrosome reaction, TMEM225 is lost from the dorsal region of the acrosome . In situ hybridization studies have shown that TMEM225 mRNA is primarily expressed in spermatocyte cells and round spermatids .

How does TMEM225 expression change during development?

TMEM225 expression shows age-related specificity in the testis. In rats, significant expression has been observed specifically during the adult period after 13 months of age. This temporal expression pattern suggests that TMEM225 may be more important for sperm maturation and function rather than initial spermatogenesis. Interestingly, research has indicated that the expression phase is not related to the first wave of spermatozoon development, which has led to suggestions that TMEM225 may play an important role in sperm maturation processes rather than early spermatogenesis .

What is the primary function of TMEM225 in mouse reproduction?

TMEM225 is essential for sperm maturation and male fertility. Knockout studies have revealed that male mice lacking TMEM225 are infertile. Importantly, while Tmem225 deletion does not affect spermatogenesis itself, TMEM225-null sperm exhibit significant abnormalities during epididymal maturation. These abnormalities include reduced sperm motility, abnormal hairpin-loop configuration, elevated reactive oxygen species (ROS) levels, and flagellar folding, collectively manifesting as asthenospermia (poor sperm motility). These findings indicate that TMEM225 controls critical aspects of the sperm maturation process, particularly in the epididymis .

How does TMEM225 interact with protein phosphatase 1γ2 (PP1γ2)?

TMEM225 contains an RVxF motif, which is a consensus site for interaction with serine/threonine protein phosphatase 1 (PP1). Biochemical studies have confirmed that TMEM225 interacts with PP1 in vivo. Pull-down assays have specifically demonstrated that the carboxy-terminal region of TMEM225 can bind to PP1γ2, which is the predominant isoform of PP1 in male germ cells. Furthermore, TMEM225 inhibits PP1γ2 activity in vitro through its RVxF motif. This regulatory role suggests that TMEM225 modulates sperm differentiation and function by regulating PP1γ2 activity, which is known to be necessary for normal spermatogenesis as well as spermatozoa capacitation and motility .

What molecular pathways are affected in TMEM225-null sperm?

Proteomic analyses of cauda sperm from TMEM225 knockout mice have revealed several dysregulated pathways:

  • Mitochondrial function pathways: Impaired energy production affecting sperm motility

  • Glycolytic pathways: Altered energy metabolism critical for sperm function

  • Sperm flagellar morphology pathways: Leading to structural abnormalities in sperm flagella

These molecular alterations collectively contribute to the observed high reactive oxygen species levels, reduced motility, and flagellar folding that characterize TMEM225-null sperm. The data suggest that testicular TMEM225 controls sperm maturation by regulating the expression of proteins involved in these critical pathways during epididymal transit and maturation .

What are the recommended approaches for generating and validating TMEM225 antibodies?

Based on published research protocols, the recommended approach for generating TMEM225 antibodies involves:

  • Peptide selection: Design antibodies against the carboxy-terminal region of mouse TMEM225. The sequence 217NRPHTQARRVTWAL230 has been successfully used in previous studies.

  • Conjugation method: Conjugate the selected peptide to keyhole limpet hemocyanin (KLH).

  • Immunization protocol: Raise rabbit polyclonal antibodies against the KLH-conjugated peptide following standard immunization schedules.

  • Validation tests:

    • Western blotting against testicular lysates (comparing wild-type vs. knockout tissues)

    • Immunohistochemistry with appropriate controls

    • Pre-absorption controls with the immunizing peptide

    • Testing antibody specificity across multiple species if cross-reactivity is desired

This approach ensures generation of specific antibodies that can reliably detect TMEM225 in various experimental contexts.

What techniques are most effective for studying TMEM225 localization in sperm?

Multiple complementary techniques should be employed for accurate localization studies:

  • Immunofluorescence microscopy: Offers high-resolution imaging of TMEM225 distribution in fixed sperm. Critical controls include TMEM225 knockout samples and peptide pre-absorption controls.

  • Subcellular fractionation followed by Western blotting: Allows biochemical verification of TMEM225 presence in specific cellular compartments (e.g., membrane fractions).

  • Immunoelectron microscopy: Provides ultrastructural localization, particularly important for resolving TMEM225's precise distribution within the complex acrosomal region.

  • GFP fusion protein expression: Complementary approach to validate localization patterns observed with antibody-based methods.

Studies have demonstrated that TMEM225 localizes to the equatorial segment of the acrosome in mature spermatozoa but is absent from the midpiece and tail. Additionally, GFP localization analysis in rats has shown that TMEM225 primarily surrounds the nuclear membrane, with some distribution in the cytoplasm .

What are the key considerations when designing a TMEM225 knockout mouse model?

Based on successful previous studies, researchers should consider:

  • Targeting strategy:

    • Design targeting constructs to disrupt critical exons encoding transmembrane domains

    • Consider conditional knockout approaches if complete knockout causes infertility

  • Verification methods:

    • PCR genotyping with specific primers for wild-type and mutant alleles

    • RT-PCR and Western blotting to confirm absence of TMEM225 mRNA and protein

    • Immunohistochemistry to verify protein absence in testicular sections

  • Housing conditions:

    • Maintain mice under specific pathogen-free conditions at controlled temperature (22 ± 1°C)

    • Expose to constant 12-h light-dark cycle as used in published studies

  • Phenotypic analysis focus:

    • Comprehensive fertility assessment

    • Detailed sperm analysis (concentration, morphology, motility)

    • Comparative histological examination of testes and epididymides

    • Assessment of sperm maturation markers

How can proteomics approaches be optimized for studying TMEM225-dependent changes in sperm proteins?

For optimal proteomic analysis of TMEM225-dependent sperm protein changes, researchers should consider:

  • Sample preparation:

    • Carefully isolate cauda epididymal sperm using swim-up methods to ensure purity

    • Employ stringent washing steps to remove epididymal fluid contaminants

    • Use appropriate protease inhibitors to prevent degradation

  • Mass spectrometry approach:

    • Implement Orbitrap Q Exactive HF mass spectrometer or similar high-resolution instruments

    • Use these recommended parameters:

      • MS1: Resolution 60,000, scan range 350-1600 m/z, AGC 3e6, maximum injection time 50 ms

      • MS2: Resolution 30,000, charge state screening (+2 to +7 charges), dynamic elimination for 90 s

      • Collision energy: 30%

  • Comparative analysis strategy:

    • Compare wild-type and TMEM225 knockout sperm proteins

    • Focus analysis on proteins involved in:

      • Mitochondrial function

      • Glycolytic pathways

      • Sperm flagellar morphology

    • Use pathway enrichment analysis to identify systematically altered cellular processes

This approach has successfully identified functional pathways disrupted in TMEM225-null sperm, providing mechanistic insights into the observed asthenospermia phenotype.

What experimental approaches can resolve contradictory findings about TMEM225's role in spermatogenesis versus sperm maturation?

Some studies suggest TMEM225 may play a role in sperm degeneration rather than spermatogenesis , while others indicate it's essential for sperm maturation during epididymal transit . To resolve these seemingly contradictory findings, researchers should:

  • Temporal expression profiling:

    • Conduct detailed age-dependent expression analysis from prepuberty through advanced age

    • Use RNA-seq and protein quantification at multiple developmental timepoints

    • Compare expression patterns across different species (mouse, rat, human)

  • Conditional knockout approaches:

    • Generate stage-specific conditional knockout models using spermatogonia-, spermatocyte-, or spermatid-specific Cre lines

    • Compare phenotypes between these models to pinpoint the critical stage requiring TMEM225

  • Functional rescue experiments:

    • Attempt rescue of TMEM225 knockout phenotypes by expressing TMEM225 at different developmental stages

    • Create chimeric proteins to identify which domains are essential for specific functions

  • Cross-species comparative studies:

    • Detailed comparative analysis between mouse, rat, and human TMEM225 function

    • Investigate whether age-dependent effects differ between species

These approaches can help distinguish between primary effects on spermatogenesis versus secondary effects on sperm maturation and clarify the seemingly contradictory findings in the literature.

What methods can assess the impact of TMEM225 on reactive oxygen species (ROS) levels and mitochondrial function in sperm?

To thoroughly investigate TMEM225's role in regulating ROS and mitochondrial function:

  • ROS measurement techniques:

    • Flow cytometry with specific ROS indicators (H₂DCFDA, MitoSOX Red, CellROX)

    • Luminol-based chemiluminescence assays for quantitative comparison

    • Live-cell imaging of ROS dynamics in wild-type versus knockout sperm

  • Mitochondrial function assessment:

    • Seahorse XF analyzer to measure oxygen consumption rate (OCR) and extracellular acidification rate (ECAR)

    • JC-1 staining to evaluate mitochondrial membrane potential

    • Targeted metabolomics focusing on TCA cycle intermediates and related metabolites

  • Mechanistic studies:

    • Evaluate key antioxidant enzymes (SOD, catalase, GPx) at protein and activity levels

    • Assess electron transport chain complex activities in isolated sperm mitochondria

    • Measure ATP production in wild-type versus TMEM225-null sperm under different metabolic conditions

  • Intervention studies:

    • Test whether antioxidant supplementation can rescue TMEM225 knockout phenotypes

    • Evaluate whether mitochondria-targeted antioxidants show greater efficacy than general antioxidants

    • Investigate if bypassing affected energy production pathways can restore sperm function

These approaches would provide comprehensive insights into how TMEM225 regulates mitochondrial function and ROS production, which appear to be critical mechanisms underlying the observed sperm dysfunction in knockout models .

How relevant are mouse TMEM225 findings to human male infertility?

The relevance of mouse TMEM225 research to human fertility is supported by several observations:

  • Expression conservation: TMEM225 shows testis-specific expression in both mice and humans, suggesting conserved function.

  • Clinical correlations: Abnormal TMEM225 expression levels have been found in patients with nonobstructive azoospermia, indicating potential clinical relevance.

  • Phenotypic similarity: The asthenospermia phenotype observed in TMEM225 knockout mice mirrors certain forms of human male infertility.

  • Molecular pathway conservation: The pathways affected by TMEM225 deficiency (mitochondrial function, glycolysis, flagellar morphology) are all implicated in human male infertility cases.

Researchers investigating potential translational applications should consider:

  • Genetic screening for TMEM225 mutations in infertile men, particularly those with asthenospermia

  • Evaluating TMEM225 protein levels in human sperm samples as a potential biomarker

  • Exploring whether TMEM225 function could be targeted pharmaceutically to address specific forms of male infertility

What are the recommended techniques for comparing TMEM225 expression and function across species?

For effective cross-species comparison, researchers should:

  • Gene sequence analysis:

    • Conduct detailed sequence alignment and phylogenetic analysis

    • Identify conserved domains, particularly transmembrane regions and the PP1-binding motif

    • Calculate sequence homology percentages between species

  • Expression pattern comparison:

    • Use RNA-seq data from multiple species to compare tissue specificity

    • Employ cross-reactive antibodies (or species-specific antibodies) for Western blot and immunohistochemistry

    • Compare developmental timing of expression onset across species

  • Functional conservation assessment:

    • Test whether human TMEM225 can rescue mouse knockout phenotypes

    • Evaluate PP1 binding capabilities across species

    • Compare subcellular localization patterns in sperm from different species

  • Structural biology approaches:

    • Generate structural models of TMEM225 from different species

    • Compare predicted protein-protein interaction interfaces

    • Evaluate conservation of post-translational modification sites

These comparative approaches can help determine which aspects of TMEM225 function are evolutionarily conserved and therefore most likely to be relevant to human reproductive biology .

What are the major challenges in working with recombinant TMEM225 protein and how can they be addressed?

Working with recombinant transmembrane proteins like TMEM225 presents several challenges:

  • Expression system selection:

    • Challenge: Transmembrane proteins often express poorly in bacterial systems

    • Solution: Use mammalian expression systems (HEK293, CHO cells) or insect cell systems (Sf9, High Five) that better handle membrane proteins

    • Recommendation: For TMEM225, mammalian systems most closely recapitulate native folding

  • Protein solubilization and purification:

    • Challenge: Membrane proteins require detergents that can affect structure/function

    • Solution: Screen multiple detergents (DDM, CHAPS, LMNG) at varying concentrations

    • Alternative approach: Consider nanodiscs or amphipols for a more native-like environment

  • Functional assay development:

    • Challenge: Assessing PP1γ2 inhibition activity in purified systems

    • Solution: Establish in vitro phosphatase assays using purified PP1γ2 and appropriate substrates

    • Control: Include RVxF motif peptides as competitive inhibitors to validate specificity

  • Structural integrity verification:

    • Challenge: Confirming proper folding of recombinant TMEM225

    • Solution: Circular dichroism to assess secondary structure content

    • Advanced approach: Consider limited proteolysis coupled with mass spectrometry to verify structural domains

These strategies can help overcome the inherent difficulties in working with recombinant transmembrane proteins like TMEM225, facilitating more reliable functional and structural studies .

How can researchers accurately assess the impact of TMEM225 on sperm function in vitro?

To comprehensively evaluate TMEM225's impact on sperm function:

  • Computer-assisted sperm analysis (CASA):

    • Use standardized parameters for motility assessment (total motility, progressive motility, curvilinear velocity, straight-line velocity, amplitude of lateral head displacement)

    • Compare wild-type, heterozygous, and homozygous knockout sperm under identical conditions

    • Record multiple fields and time points to capture the full range of motility patterns

  • Capacitation assessment:

    • Monitor tyrosine phosphorylation patterns during capacitation

    • Evaluate hyperactivated motility development

    • Assess calcium influx patterns using fluorescent indicators

  • Acrosome reaction quantification:

    • Use multiple complementary methods (Coomassie blue staining, PNA lectin binding, anti-acrosomal antibodies)

    • Induce acrosome reaction with physiological (ZP proteins) and non-physiological (calcium ionophore) stimuli

    • Time-course studies to detect potential differences in reaction kinetics

  • Sperm-egg interaction assays:

    • Zona-binding assays with wild-type versus TMEM225-null sperm

    • Fertilization rate comparison using in vitro fertilization

    • Assessment of post-fertilization events (if fertilization occurs)

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.