Recombinant Mouse Transmembrane protein 229A (Tmem229a)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Please note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them during order placement. We will accommodate your needs to the best of our ability.
Lead Time
Delivery time may vary depending on the purchase method and location. For precise delivery estimates, please consult your local distributor.
Please note: All our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is discouraged. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure all contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final glycerol concentration is 50%. This can be used as a reference.
Shelf Life
Shelf life is influenced by various factors including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
Tag type is determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
Tmem229a; Transmembrane protein 229A
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-371
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Tmem229a
Target Protein Sequence
MAGSDVASEGPSPRDGATRRPGATGGLRSQAAASCPEPLSAAEAPAERGALPAWMRLYFY GMHGITLDVLVSSARRFARSLDLRMLGFSSPYRCLLHSLTHFALEQLYLQRPRCPSAFLF NFLLYPSAHVGLQTLAGQALRLSLGGGPGGAAAPALGALDLALQYVLALYHGQVFLKRFL CLRYPRRRDQHTRDTLPAARDAQILWEAGGQRRGPGGARGTERSPTQGLPDLLRFLFFGM HGFLDEIFFTFFFNVLGQGDRASSGHTSLWSFFMYGSCSFVVEKLYFHLHYSRGWGTWKR VPIYVIFIYAWEFSWGLGLRMCGACSWDYSHYPLNFMGLITLMYLPGWLFLSVYQDLLSN VLWRVQYVPTN
Uniprot No.

Target Background

Database Links

KEGG: mmu:319832

UniGene: Mm.127446

Protein Families
TMEM229 family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is TMEM229A and what are its primary functions?

TMEM229A (Transmembrane protein 229A) is a member of the TMEM family that plays important roles in multiple biological processes. It has been identified as a critical protein in tooth differentiation and development, demonstrating significant differential expression between permanent and deciduous teeth . TMEM229A also participates in calcium signaling pathways and has been implicated in zona pellucida binding, contributing to Ca²⁺ signaling-associated acrosomal exocytosis . Recent research has further expanded our understanding of TMEM229A function, revealing its potential role as a tumor suppressor in non-small cell lung cancer (NSCLC), where it can inhibit cell proliferation, migration, and invasion .

The protein structure of mouse TMEM229A includes transmembrane domains that anchor it within cellular membranes, with a full amino acid sequence of 371 residues. The sequence includes specific motifs associated with transmembrane proteins, including hydrophobic regions that facilitate membrane insertion and functional domains that mediate protein-protein interactions . Understanding these basic structural characteristics is essential for researchers designing experiments involving TMEM229A manipulation or analysis.

What is the expression pattern of TMEM229A in normal mouse tissues?

TMEM229A expression has been documented across various mouse tissues, with notable expression patterns in developmental contexts. In dental tissues, TMEM229A has been identified as one of three hub genes (along with LEPREL1 and GAD1) that show significant differential expression between permanent and deciduous teeth . This suggests a developmentally regulated expression pattern that correlates with tissue maturation and specialization.

How should recombinant mouse TMEM229A protein be reconstituted and stored for optimal stability?

Recombinant mouse TMEM229A is typically supplied in lyophilized form and requires proper reconstitution to maintain structural integrity and biological activity. Based on protocols for similar recombinant proteins, TMEM229A should be reconstituted at a concentration of approximately 500 μg/mL in phosphate-buffered saline (PBS) . The reconstitution process should be performed gently to avoid protein denaturation, ideally by allowing the lyophilized protein to dissolve naturally without excessive pipetting or vortexing.

For storage, recombinant TMEM229A demonstrates optimal stability when stored in a manual defrost freezer at -20°C or preferably at -80°C for extended storage . Researchers should avoid repeated freeze-thaw cycles, as these can significantly compromise protein integrity and biological activity. For ongoing experiments, working aliquots can be maintained at 4°C for up to one week . Some preparations may include 50% glycerol in a Tris-based buffer to enhance stability during storage . Proper storage conditions are crucial for maintaining the functional properties of the recombinant protein in experimental applications.

What are the recommended methods for overexpressing or silencing TMEM229A in cell culture systems?

For TMEM229A overexpression in mammalian cell culture systems, the use of expression vectors such as pcDNA3.1/myc-his has been validated in experimental settings . The full TMEM229A coding sequence should be cloned into the expression vector, and transfection can be effectively performed using Lipofectamine® 2000 reagent when cells reach 60-70% confluence . For optimal results in a 6-well plate format, approximately 2 μg of the expression vector should be used per well, with post-transfection incubation occurring at 37°C with 5% CO₂ .

For TMEM229A silencing, specific small interfering RNAs (siRNAs) targeting TMEM229A have been successfully employed. Validated siRNA sequences include:

  • si-TMEM229A#1: Forward 5′-GGAUGCGCCUCUACUUCUAdTdT-3′; Reverse 5′-UAGAAGUAGAGGCGCAUCCdTdT-3′

  • si-TMEM229A#2: Forward 5′-CCUUCGUCUUCAAUUUCCUdTdT-3′; Reverse 5′-AGGAAAUUGAAGACGAAGGdTdT-3′

These siRNAs can be transfected at a concentration of 50 nM using Lipofectamine® 2000 reagent, with cells harvested for subsequent experiments 24 hours post-transfection . Both overexpression and silencing approaches allow researchers to investigate the functional consequences of TMEM229A modulation in various experimental contexts.

What functional assays are most appropriate for studying TMEM229A's biological effects?

Based on the documented functions of TMEM229A, several functional assays have been validated for investigating its biological effects. For assessing effects on cell proliferation, both Cell Counting Kit-8 (CCK-8) assays and clonogenic assays have proven effective . In clonogenic assays, cells transfected with TMEM229A-modulating constructs should be seeded at a density of 1×10³ cells/well in 6-well plates and cultured for approximately 10 days before fixation and staining with crystal violet .

For migration and invasion assays, real-time cellular analysis using the xCELLigence system has provided valuable insights into TMEM229A function . This approach involves seeding 1×10³ to 1×10⁴ transfected cells (depending on the cell line) in E-plates with appropriate media conditions, followed by real-time monitoring using xCELLigence software . Traditional Transwell assays have also been effectively employed to assess migration and invasion capabilities in the context of TMEM229A modulation .

For investigating TMEM229A's effect on signaling pathways, western blot analysis focusing on epithelial-mesenchymal transition (EMT)-related proteins (E-cadherin, N-cadherin, Snail) and phosphorylation states of signaling molecules (ERK, AKT) has revealed important mechanistic insights . These assays collectively provide a comprehensive toolset for characterizing TMEM229A's functional impact in various experimental models.

How is TMEM229A expression altered in cancer models, particularly NSCLC?

TMEM229A expression exhibits significant downregulation in NSCLC tissues compared to adjacent normal lung tissues, suggesting its potential role as a tumor suppressor . This downregulation has been verified through multiple techniques including reverse transcription-quantitative PCR (RT-qPCR), western blotting, and immunohistochemical analysis . The reduced expression pattern extends across several established NSCLC cell lines when compared to normal bronchial epithelial BEAS-2B cells .

Analysis of clinical specimens has revealed important correlations between TMEM229A expression levels and clinical parameters in NSCLC patients. Low TMEM229A expression shows significant associations with poor tumor differentiation (p=0.043), presence of lymphatic invasion (p=0.008), cancer thrombus (p=0.012), and advanced disease stage (p=0.040) . The table below summarizes these clinical associations:

TMEM229A expression
Variables
Tumor differentiation
Well/Moderate
Poor
Lymphatic invasion
Present
Absent
Cancer thrombus
Present
Absent
Stage
I+II
III+IV

These clinical correlations provide important context for researchers studying TMEM229A in cancer models and may guide experimental designs focused on its tumor suppressive mechanisms.

What is the prognostic significance of TMEM229A expression in cancer?

Survival analysis of lung adenocarcinoma and squamous cell lung carcinoma cases has demonstrated that low TMEM229A expression correlates with poor prognosis . This prognostic relationship has been validated using multiple independent datasets, including GEO datasets (GSE4573, GSE14814, GSE8894, GSE19188, GSE3141, GSE31210, GSE29013, and GSE37745) and TCGA datasets, encompassing a total of 1,233 patient samples .

Through which signaling pathways does TMEM229A exert its biological effects?

TMEM229A has been shown to modulate several key signaling pathways that influence cellular behavior. In NSCLC, mechanistic studies have demonstrated that TMEM229A overexpression effectively increases E-cadherin expression while reducing N-cadherin, Snail family transcriptional repressor 1, and MMP2 expression . This expression pattern indicates that TMEM229A suppresses epithelial-mesenchymal transition (EMT), a critical process in cancer progression and metastasis.

Additionally, TMEM229A overexpression significantly reduces the phosphorylation levels of ERK and AKT, key components of the MAPK and PI3K/AKT signaling pathways, respectively . This inhibitory effect on ERK phosphorylation appears particularly important, as the incorporation of the specific ERK inhibitor PD98059 partially suppresses the effects of TMEM229A overexpression . These findings suggest that TMEM229A's inhibitory effects on cell proliferation, migration, and invasion are at least partially mediated through inactivation of the ERK signaling pathway.

In developmental contexts, TMEM229A has been linked to calcium signaling pathways, particularly in relation to tooth development and differentiation . Its role in Ca²⁺ signaling-associated acrosomal exocytosis further supports its involvement in calcium-dependent cellular processes . Understanding these multiple signaling mechanisms provides important insights for researchers designing pathway-focused experiments involving TMEM229A.

How can recombinant TMEM229A be utilized in protein-binding studies?

Recombinant mouse TMEM229A, particularly in its carrier-free form without bovine serum albumin (BSA), provides an excellent tool for protein-binding studies . When immobilized at concentrations of approximately 1 μg/mL (100 μL/well), recombinant TMEM229A can be used to investigate binding affinities with potential interaction partners . For example, binding studies with recombinant human PTPRD Fc Chimera have demonstrated specific interactions with ED₅₀ values in the range of 80.0-800 ng/mL .

For researchers conducting protein-binding studies, it's important to note that the recombinant TMEM229A protein structure may contain post-translational modifications that influence binding affinity. SDS-PAGE analysis under reducing and non-reducing conditions has shown that recombinant mouse TMEM229A resolves as bands between 45-62 kDa, suggesting potential glycosylation or other modifications . This heterogeneity should be considered when designing and interpreting protein-binding experiments.

Advanced techniques such as surface plasmon resonance (SPR) or isothermal titration calorimetry (ITC) could provide quantitative binding parameters for TMEM229A interactions. These approaches would complement the qualitative or semi-quantitative information obtained from traditional binding assays and could reveal important kinetic and thermodynamic properties of TMEM229A-partner interactions.

What are the most effective approaches for studying TMEM229A in vivo?

While the search results do not provide specific details on in vivo models for TMEM229A research, several approaches can be inferred based on its documented functions and expression patterns. Given TMEM229A's role in developmental processes, particularly tooth development, developmental mouse models represent valuable systems for investigating its in vivo function . These could include temporal and spatial expression analyses during embryonic and postnatal development, particularly focusing on tissues where TMEM229A shows prominent expression.

For studying TMEM229A's tumor suppressive functions in vivo, xenograft models using NSCLC cell lines with modulated TMEM229A expression (overexpression or knockdown) would provide important insights into its effects on tumor growth and metastasis . Additionally, genetically engineered mouse models (GEMMs) with conditional TMEM229A knockout or overexpression in specific tissues could reveal tissue-specific functions and potential developmental consequences of TMEM229A modulation.

For researchers interested in TMEM229A's role in calcium signaling, in vivo calcium imaging in appropriate model systems could provide valuable functional data. Combining these approaches with molecular and cellular analyses would provide a comprehensive understanding of TMEM229A's in vivo functions across different biological contexts.

What are common challenges when working with recombinant TMEM229A and how can they be addressed?

Researchers working with recombinant TMEM229A may encounter several technical challenges. One common issue involves protein stability and activity retention after reconstitution. To address this, it's recommended to reconstitute the lyophilized protein at the optimal concentration (approximately 500 μg/mL in PBS) and prepare small working aliquots to avoid repeated freeze-thaw cycles . Adding carrier proteins or stabilizing agents may be necessary for certain applications, though carrier-free preparations are preferred when the presence of additional proteins could interfere with experimental outcomes .

Another challenge involves achieving efficient transfection when overexpressing or silencing TMEM229A in cell culture systems. Optimizing transfection conditions for specific cell types is essential, including adjusting cell density (60-70% confluence is generally optimal), transfection reagent concentration, and DNA/RNA quantities . For siRNA-mediated knockdown, using multiple validated siRNA sequences (such as si-TMEM229A#1 and si-TMEM229A#2) can help confirm specificity and reduce off-target effects .

For functional assays, selecting appropriate positive and negative controls is crucial for meaningful data interpretation. When studying TMEM229A's effects on signaling pathways, including specific pathway inhibitors (such as the ERK inhibitor PD98059) can help establish mechanistic relationships between TMEM229A and downstream effectors . These methodological considerations are essential for generating robust and reproducible data in TMEM229A research.

How can researchers validate antibodies for TMEM229A detection in different experimental contexts?

Antibody validation is critical for accurate TMEM229A detection and represents a significant methodological consideration. For western blot applications, researchers should validate antibodies using positive controls (tissues or cell lines with known TMEM229A expression) and negative controls (TMEM229A knockdown samples or tissues from knockout models if available). Comparing multiple antibodies targeting different epitopes can provide additional validation.

For immunohistochemistry or immunofluorescence applications, antibody specificity should be confirmed using similar control samples, with particular attention to potential cross-reactivity with other transmembrane proteins. Peptide blocking experiments, where the antibody is pre-incubated with the immunizing peptide, can provide additional specificity confirmation.

Researchers should also consider the potential impact of fixation methods on TMEM229A epitope accessibility, particularly given its transmembrane localization. Different fixation protocols may be required for optimal detection in different experimental contexts. These validation approaches are essential for ensuring reliable and reproducible TMEM229A detection across various experimental applications.

What are emerging areas of TMEM229A research that require further investigation?

Several promising research directions for TMEM229A warrant further investigation. One emerging area involves exploring TMEM229A's role in other cancer types beyond NSCLC. Given its documented tumor suppressive functions in lung cancer, investigating whether similar mechanisms operate in other epithelial cancers could reveal broader implications for cancer biology .

Another important research direction involves elucidating the precise molecular mechanisms through which TMEM229A regulates calcium signaling. While its involvement in calcium-dependent processes has been documented, the specific calcium channel components or calcium-binding proteins with which it interacts remain to be fully characterized . Advanced techniques such as calcium imaging combined with TMEM229A manipulation could provide valuable insights into these mechanisms.

The potential role of TMEM229A mutations in disease pathogenesis also represents an important area for future research. Preliminary findings have indicated that a TMEM229A Q200del mutation may be associated with histopathologic type and lymphatic metastasis in lung adenocarcinoma . Expanding these investigations to include comprehensive mutational analyses in various disease contexts could reveal important structure-function relationships and potential disease associations.

How might single-cell approaches enhance our understanding of TMEM229A biology?

Single-cell technologies offer powerful approaches for advancing TMEM229A research. Single-cell RNA sequencing (scRNA-seq) could reveal cell type-specific expression patterns and potential heterogeneity in TMEM229A expression within tissues, providing important context for its functional roles. This approach would be particularly valuable in developmental settings, such as tooth development, where TMEM229A shows significant differential expression .

In cancer contexts, single-cell approaches could identify specific cell populations within tumors that exhibit differential TMEM229A expression and correlate these patterns with cellular states or phenotypes. This might reveal important insights into the cellular mechanisms underlying TMEM229A's tumor suppressive functions and identify potential therapeutic targets for restoring TMEM229A activity in cancer cells .

Additionally, single-cell proteomics and spatial transcriptomics approaches could provide unprecedented insights into TMEM229A's subcellular localization, co-expression patterns with interaction partners, and spatial distribution within tissues. These advanced technologies would complement traditional approaches and potentially reveal novel aspects of TMEM229A biology that have been challenging to address with bulk analysis methods.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.