Recombinant Mouse Transmembrane protein 229B (TMEM229B)

Shipped with Ice Packs
In Stock

Description

Gene and Protein Overview

TMEM229B (UniProt ID: Q8BFQ2) is encoded by the Tmem229b gene (Gene ID: 268567) in mice. The protein spans 167 amino acids and contains transmembrane domains, though its exact biological function remains under investigation . Key features include:

ParameterValue
Gene NameTmem229b
Protein Length167 amino acids
Subcellular LocationMembrane-bound
OrthologsHuman (Q8NBD8), Rat, Zebrafish, Chicken, Guinea Pig

Mammalian Cell-Expressed (His-Tagged)

PropertyDetail
SourceMammalian cells (e.g., HEK293)
TagN-terminal His-tag
Purity>80% (SDS-PAGE)
Endotoxin Level<1.0 EU/μg
Storage BufferPBS buffer
Storage Conditions-20°C to -80°C (long-term), +4°C (short-term)

Bacterial Expression (Human Ortholog)

PropertyDetail
SourceE. coli
TagHis-tag (N-terminal)
Purity>90% (SDS-PAGE)
Protein LengthFull-length (1-167 aa)
Storage BufferTris/PBS with 6% trehalose

Research Applications

TMEM229B is utilized in diverse experimental contexts:

Protein Expression and Detection

  • Western Blot/ELISA: Antibodies targeting TMEM229B (e.g., HPA046562) enable detection in lysates .

  • Stable Cell Lines: Lentiviral vectors (e.g., pLenti-GIII-CMV) allow CMV-driven expression for sustained studies .

Functional Studies

  • Pathway Analysis: Though direct pathways are uncharacterized, TMEM229B may interact with membrane-associated complexes .

  • Structural Biology: His-tagged variants facilitate affinity purification for crystallography or NMR .

Stability and Handling

Proper handling ensures optimal activity:

ParameterRecommendation
Freezing/ThawingAvoid repeated cycles; aliquot for single-use
ReconstitutionUse deionized water; add glycerol (5-50%) for stability
Long-Term Storage-80°C for lyophilized powder; -20°C for liquid stocks

Comparative Analysis of Recombinant TMEM229B Products

The choice of product depends on experimental needs:

FeatureMouse (Mammalian) Human (E. coli)
TagHisHis
Post-Translational ModificationsNative (glycosylation, etc.)Limited (bacterial system)
Purity>80%>90%
Expression SystemMammalian cellsE. coli
End UseNative protein studiesHigh-purity structural studies

Research Challenges and Gaps

  • Functional Annotation: Limited data on TMEM229B’s role in cellular processes .

  • Interaction Partners: No confirmed binding proteins or pathways reported .

  • Species-Specific Variations: Mouse and human orthologs show sequence divergence, necessitating cross-species validation .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, we are happy to accommodate specific format requests. Please indicate your preferred format in the order notes and we will strive to fulfill your needs.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for accurate delivery timelines.
Note: Our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance as additional charges will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%, which can serve as a reference point.
Shelf Life
Shelf life is influenced by various factors such as storage conditions, buffer components, temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type is determined during production. If you have a specific tag type preference, please communicate it to us. We will prioritize fulfilling your specified tag requirements.
Synonyms
TMEM229B; Transmembrane protein 229B
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-167
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
TMEM229B
Target Protein Sequence
MASAEPLTALSRWYLYAIHGYFCEVMFTAAWEFVVNFNWKFPGVTSVWALFIYGTSILIV ERMYLRLRGRCPLLVRCVIYTLWTYLWEFTTGFILRQFNACPWDYSQFDFDFMGLITLEY AVPWFCGALIMEQFIIRNTLRLRFDKDAEPGEPASPPALANGHVKTD
Uniprot No.

Target Background

Database Links

KEGG: mmu:268567

UniGene: Mm.341747

Protein Families
TMEM229 family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is the basic structure and characteristics of mouse TMEM229B?

Mouse TMEM229B is a transmembrane protein with 167 amino acids and a predicted molecular weight of approximately 19.5 kDa. The protein contains a domain of unknown function (DUF1113) spanning amino acids 87 to 135. TMEM229B is highly conserved across vertebrates, suggesting evolutionary importance. The encoding gene is located on chromosome 14 at position 14q24.1, spans approximately 45,038 base pairs, and contains 3 exons in its primary transcript . There are multiple transcript variants (at least 7) that have been identified, ranging in mRNA size from 519 bp to 5008 bp .

What is the expression pattern of TMEM229B in mouse tissues?

TMEM229B demonstrates ubiquitous expression throughout the body with tissue-specific variation in expression levels. Higher expression is observed in parathyroid, skin, and thyroid tissues. Moderate expression is seen in bone marrow, trachea, spleen, eye, brain, pancreas, mammary gland, intestine, liver, thymus, lymph node, ovarian, muscle, lung, blood, and kidney tissues . For mouse-specific studies, researchers should consider these expression patterns when designing experiments targeting specific tissue functions.

How conserved is TMEM229B across species and what implications does this have for research?

TMEM229B is highly conserved across vertebrates, including portions of the 3'UTR region . This conservation suggests important functional roles that have been maintained throughout evolution. Researchers can leverage this conservation for comparative studies between mouse models and human applications. When designing recombinant TMEM229B experiments, understanding cross-species similarities and differences is crucial for translational research validity.

What expression systems are recommended for producing recombinant mouse TMEM229B?

Several expression systems have been validated for producing recombinant mouse TMEM229B, including mammalian cells (particularly HEK293) and E. coli . When selecting an expression system, consider:

  • Mammalian expression systems: Preferred for maintaining proper protein folding and post-translational modifications that may be essential for TMEM229B functionality

  • E. coli expression: Offers higher protein yields but may lack critical post-translational modifications

  • Insect cell systems: Can be considered as an intermediate option

The choice should be guided by your specific experimental requirements and downstream applications.

What purification tags are most effective for recombinant mouse TMEM229B isolation?

Multiple affinity tags have been successfully employed for TMEM229B purification, including His, DDK, Myc, Avi, and Fc tags . Consider these methodological approaches:

  • His-tag: Provides efficient purification using immobilized metal affinity chromatography (IMAC)

  • Fc-fusion: Offers improved solubility and detection capabilities

  • Avi-tag: Enables site-specific biotinylation for specialized applications

Tag selection should be based on your purification strategy, detection methods, and whether the tag needs to be removed for functional studies.

What methods can be used to validate the expression and functionality of recombinant mouse TMEM229B?

To validate recombinant TMEM229B:

  • Western blot analysis using specific antibodies against TMEM229B or the fusion tag

  • Mass spectrometry for protein identification and characterization

  • Circular dichroism to assess proper protein folding

  • Functional assays based on hypothesized protein function (limited by current understanding)

  • RT-qPCR using GAPDH as a reference gene for expression studies, as implemented in diabetic rat models

What is currently known about the biological function of TMEM229B?

The specific biological function of TMEM229B remains largely undefined, with the protein containing a domain of unknown function (DUF1113) . Current research suggests potential roles in:

  • Cellular membrane organization and function

  • Possible involvement in apoptotic pathways, as suggested by studies in STZ-induced diabetic rats

  • Potential involvement in cellular response pathways, though specific mechanisms remain to be elucidated

This gap in knowledge presents valuable research opportunities for characterizing TMEM229B function through knockout/knockdown studies, interaction analyses, and localization experiments.

How can researchers design experiments to elucidate TMEM229B function in mouse models?

To investigate TMEM229B function:

  • CRISPR/Cas9-mediated gene editing to create knockout or knockdown models

  • Overexpression systems using various promoters to assess dose-dependent effects

  • Co-immunoprecipitation studies to identify protein interaction partners

  • Subcellular localization studies using fluorescently tagged TMEM229B

  • Tissue-specific conditional knockouts to evaluate function in different physiological contexts

  • Transcriptome analysis in models with altered TMEM229B expression

These approaches should be complementary and integrated with phenotypic assessments to comprehensively characterize TMEM229B function.

What protein interactions have been identified for mouse TMEM229B?

Current literature provides limited information on specific protein-protein interactions for TMEM229B. Research strategies to identify interaction partners include:

  • Affinity purification followed by mass spectrometry (AP-MS)

  • Yeast two-hybrid screening

  • Proximity labeling techniques such as BioID or APEX

  • Co-immunoprecipitation with candidate interacting proteins

These approaches can help construct an interaction network to better understand TMEM229B's cellular function and molecular mechanisms.

What is the evidence for TMEM229B involvement in neurodegenerative disorders?

Genetic analysis has investigated TMEM229B's potential role in Parkinson's Disease (PD). A large-scale study in a Chinese cohort examined rare and common variants of multiple TMEM family genes, including TMEM229B . The findings suggest:

  • TMEM229B was not strongly associated with PD risk, unlike some other TMEM family members

  • The association of TMEM229B locus with PD has shown inconsistent results across different studies

  • Researchers concluded that "TMEM229B may not play a vital role in PD"

How has TMEM229B been studied in diabetes research models?

TMEM229B has been investigated in relation to diabetes pathophysiology:

  • Studies have examined TMEM229B expression in streptozotocin (STZ)-induced diabetic rat models

  • Research has focused on potential connections between TMEM229B expression and apoptotic pathways in pancreatic beta cells

  • GAPDH has been used as a reference gene for expression studies in these models

The exact role of TMEM229B in diabetes pathophysiology remains to be fully elucidated, presenting opportunities for further mechanistic studies.

How should researchers address the challenge of studying a protein with undefined function like TMEM229B?

For proteins with undefined functions like TMEM229B, consider these research strategies:

  • Evolutionary analysis across species to identify conserved functional domains

  • Comparative analysis with other TMEM family proteins that have better-characterized functions

  • Systematic phenotypic screening using CRISPR libraries in relevant cell types

  • Structural biology approaches including crystallography or cryo-EM to determine protein structure

  • Multi-omics approaches combining proteomics, transcriptomics, and metabolomics data

  • Development of specific antibodies or nanobodies for functional blocking experiments

These complementary approaches can help establish working hypotheses about TMEM229B function.

What considerations should be made when interpreting contradictory data about TMEM229B?

When facing contradictory data:

  • Carefully evaluate experimental conditions, cell/tissue types, and model systems used in different studies

  • Consider species-specific differences that may affect TMEM229B function or expression

  • Assess technical variations in recombinant protein production (expression systems, tags, purification methods)

  • Examine post-translational modifications that may vary between experimental systems

  • Consider context-dependent functions that may explain seemingly contradictory observations

  • Implement multiple methodological approaches to validate key findings

A systematic approach to reconciling contradictory data is essential for advancing TMEM229B research.

What are the current technical challenges in studying transmembrane proteins like TMEM229B?

Technical challenges specific to transmembrane protein research include:

  • Protein solubility and stability issues during purification

  • Maintaining native conformation outside the membrane environment

  • Difficulties in crystallization for structural studies

  • Challenges in determining proper orientation and topology within membranes

  • Limited availability of specific antibodies for detection and functional studies

  • Determining localization to specific cellular compartments

Researchers should consider these challenges when designing experiments and interpreting results related to TMEM229B.

What emerging technologies might advance our understanding of TMEM229B function?

Emerging technologies with potential to advance TMEM229B research include:

  • Single-cell multi-omics for tissue-specific expression analysis

  • CRISPR activation/interference systems for precise functional studies

  • Advances in membrane protein structural biology, including cryo-EM

  • Organoid models for studying tissue-specific functions

  • Protein-protein interaction mapping using proximity labeling techniques

  • Machine learning approaches to predict function from sequence and structure

Integrating these technologies could accelerate discoveries about TMEM229B's biological role.

What are the most promising research directions for elucidating TMEM229B function?

Based on current knowledge, promising research directions include:

  • Investigation of potential roles in apoptotic pathways, particularly in pancreatic beta cells

  • Comprehensive interaction network mapping to identify functional contexts

  • Tissue-specific knockout studies focusing on tissues with high expression levels

  • Transcriptomic and proteomic profiling in response to TMEM229B modulation

  • Comparative functional studies with other TMEM family proteins

  • Exploring potential involvement in membrane trafficking or organization

These directions could provide significant insights into TMEM229B biology.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.