Recombinant Mouse Transmembrane protein 233 (Tmem233)

What is Tmem233 and what is its role in neuronal function?

Tmem233 (Transmembrane protein 233) is a member of the dispanin family of transmembrane proteins that is expressed in sensory neurons. Recent research has established that TMEM233 is a previously unknown Na₍v₎1.7-interacting protein that plays a critical role in modulating the gating properties of voltage-gated sodium channels . When co-expressed with Na₍v₎1.7 in heterologous expression systems, TMEM233 has been shown to modulate channel gating characteristics, suggesting it functions as an accessory protein to these important neuronal channels . Methodologically, this function was demonstrated through electrophysiology experiments in which TMEM233 was either present or absent, showing significant differences in Na₍v₎ channel behavior when the protein was expressed.

What are the known gene and protein characteristics of mouse Tmem233?

Mouse Tmem233 has been characterized at both the genetic and protein level. The mouse recombinant Tmem233 protein has a molecular weight of 11,997 Da . The full sequence of the protein is known to be: MSQYASRSDSKGALDSSPEAYTEDDKTEEDIPASNYLWLTIISCFCPAYPVNIVALVFSIMSLNSYNDGDYEGARRLGRNAKWVAIASIIIGLIIGVSCAVHFSRNP . The gene has aliases including DSPB2 and Gm13843 according to NCBI data . For experimental research, it's important to note that recombinant mouse Tmem233 is typically available in liquid form containing glycerol at concentrations achieving ≥85% purity as determined by SDS-PAGE . When working with this protein, researchers should consider that it represents the full-length protein (amino acids 1-110), which is crucial for maintaining native conformation and functionality in experimental systems.

How does Tmem233 interact with voltage-gated sodium channels and what are the functional consequences?

TMEM233 has been identified as a critical interacting partner of Na₍v₎1.7 channels, where it serves as an accessory protein that modulates channel gating . Co-expression of TMEM233 with Na₍v₎1.7 in heterologous expression systems produces specific effects on Na₍v₎ current inactivation that mirror those observed in dorsal root ganglion (DRG) neurons and TE-671 cells . Methodologically, researchers investigating this interaction should employ patch-clamp electrophysiology to measure changes in channel kinetics, particularly focusing on inactivation parameters.

The functional consequences of this interaction are significant: TMEM233 appears to be essential for certain toxins, particularly ExTxA, to modulate Na₍v₎ channel function . When TMEM233 is knocked down using CRISPR/Cas9 in TE-671 cells or in neurons from Tmem233 knockout mice, the effects of ExTxA on Na₍v₎ inactivation are abolished . This suggests that TMEM233 either directly facilitates toxin binding to Na₍v₎ channels or induces conformational changes in the channel that enable toxin activity. When designing experiments to study this interaction, researchers should consider both direct binding assays (such as co-immunoprecipitation) and functional studies (electrophysiology) to comprehensively characterize the relationship.

What experimental approaches are most effective for studying Tmem233-toxin interactions?

Several complementary approaches have proven effective for studying Tmem233-toxin interactions:

• Biotinylated toxin binding assays: Using biotinylated ExTxA has successfully demonstrated binding to TMEM233, with confocal microscopy revealing punctate toxin labeling predominantly on the cell surface .

• Electrophysiology with controlled toxin exposure: Experiments comparing the effects of ExTxA included in intracellular solution versus extracellular solution have shown that the toxin only affects Na₍v₎1.7 inactivation when applied extracellularly in cells co-expressing TMEM233 . This methodological approach helps determine the directionality of the interaction.

• Calcium imaging: Ca²⁺-influx measurements in DRG neurons have demonstrated that TMEM233 is important for ExTxA-evoked action potential firing, providing a functional readout of the interaction .

• Behavioral studies: In vivo nocifensive behavior measurements in Tmem233 knockout mice have shown significantly reduced responses to ExTxA, confirming the physiological relevance of the interaction .

For optimal results, researchers should employ a combination of these approaches, as each provides distinct but complementary information about the nature and consequences of Tmem233-toxin interactions.

What is the role of Tmem233 in pain signaling based on current evidence?

Current evidence strongly suggests that Tmem233 plays a significant role in pain signaling pathways, particularly through its interaction with Na₍v₎1.7 channels and its mediation of toxin effects on these channels . Knockout studies have shown that Tmem233 Cre/Cre KO mice exhibit significantly reduced ExTxA-induced nocifensive behaviors compared to wild-type mice . This indicates that Tmem233 is required for the full pain response to this toxin.

Additionally, the modulation of Na₍v₎1.7 gating by TMEM233 may have broader implications for pain signaling beyond toxin responses. Na₍v₎1.7 is a critical channel in pain perception, and alterations in its gating properties can significantly affect neuronal excitability and pain thresholds. The discovery that TMEM233 co-expression affects Na₍v₎1.7 properties suggests it may be involved in setting baseline sensitivity of pain-sensing neurons.

For researchers investigating pain mechanisms, methodologically, it would be valuable to examine changes in pain behaviors across various modalities (mechanical, thermal, chemical) in Tmem233 knockout models, and to conduct electrophysiological studies of sensory neurons from these animals to characterize alterations in excitability and action potential generation.

What are the optimal expression systems for functional studies of recombinant Tmem233?

When designing experiments to study the function of recombinant Tmem233, several expression systems have proven effective:

• Heterologous expression in HEK293 cells: Co-expression of TMEM233 with Na₍v₎1.7 in HEK293 cells has successfully recapitulated the effects observed in neurons, making this an excellent system for studying channel modulation . This system is particularly valuable for electrophysiological studies of channel function.

• TE-671 cell line: This cell line endogenously expresses components necessary for TMEM233 function and has been effectively used in CRISPR/Cas9 knockdown studies of TMEM233 .

• Primary DRG neuron cultures: For studies requiring a more physiologically relevant environment, primary sensory neurons provide an excellent model system, as they naturally express both TMEM233 and Na₍v₎ channels .

Methodologically, when working with these systems, it's important to verify protein expression through immunoblotting or immunofluorescence. For functional studies, whole-cell patch-clamp electrophysiology remains the gold standard for assessing changes in Na₍v₎ channel properties. Calcium imaging provides a complementary approach for assessing neuronal activity in response to various stimuli.

How can researchers effectively generate and validate Tmem233 knockout models?

Generating and validating Tmem233 knockout models requires careful attention to several methodological considerations:

• CRISPR/Cas9 genome editing: This has been successfully employed to knock down TMEM233 in cell lines such as TE-671 . When designing guide RNAs, target early exons to ensure complete loss of function.

• Germline knockout mice: Tmem233 Cre/Cre knockout mice have been developed and used to study the role of this protein in toxin responses . These models are valuable for investigating both cellular and behavioral phenotypes.

Validation of knockout models should employ multiple complementary approaches:

• Genomic verification: PCR and sequencing to confirm the intended genetic modification.

• Transcript analysis: RT-PCR or RNA-seq to confirm absence of Tmem233 mRNA.

• Protein detection: Western blotting or immunohistochemistry using specific antibodies to verify absence of the protein.

• Functional validation: Electrophysiological measurements to confirm loss of TMEM233-dependent effects, such as the response to ExTxA on Na₍v₎ channels .

A comprehensive validation approach increases confidence in the specificity of any phenotypes observed in the knockout model.

What techniques are most effective for studying Tmem233 membrane topology?

Understanding the membrane topology of Tmem233 is crucial for interpreting interaction studies. The following methodological approaches have proven effective:

• Epitope tagging combined with selective permeabilization: By creating constructs with HA tags at either the N- or C-terminus and performing immunofluorescence under permeabilized and non-permeabilized conditions, researchers have successfully determined that TMEM233 has an intracellular N-terminus and an extracellular C-terminus .

• Flow cytometry with selective permeabilization: This provides a quantitative approach to assess the accessibility of epitope tags and has confirmed the single transmembrane topology of TMEM233 .

• Protease protection assays: Although not explicitly mentioned in the provided research, these assays can provide complementary evidence for protein topology by determining which regions are protected from protease digestion.

• Glycosylation mapping: Analysis of glycosylation patterns can identify extracellular domains, as glycosylation occurs in the ER lumen and is therefore present on extracellular or luminal domains.

By combining these approaches, researchers can build a comprehensive understanding of TMEM233's orientation in the membrane, which is essential for interpreting interaction studies and designing targeted experiments.

How should electrophysiological data on Tmem233-Na₍v₎ channel interactions be analyzed?

Electrophysiological analysis of Tmem233-Na₍v₎ channel interactions requires careful consideration of multiple parameters:

• Inactivation kinetics: Since TMEM233 affects Na₍v₎ channel inactivation, analyze the time constants of fast and slow inactivation components. Compare voltage-dependence of inactivation (h∞) curves between conditions with and without TMEM233 expression .

• Persistent current measurements: Quantify the persistent current as a percentage of peak current, as TMEM233 co-expression with Na₍v₎1.7 in the presence of ExTxA leads to significant persistent currents .

• Activation parameters: Analyze potential shifts in the voltage-dependence of activation (V₁/₂) and changes in activation kinetics.

• Channel recovery from inactivation: Measure the time course of recovery from inactivation using paired-pulse protocols.

Statistical analysis should include appropriate paired tests when comparing the same cells before and after toxin application, and unpaired tests when comparing different experimental groups (e.g., with/without TMEM233 expression). Report all electrophysiological parameters as mean ± SEM with clear indication of sample sizes and statistical significance.

What are the key considerations when analyzing protein-protein interactions involving Tmem233?

When analyzing protein-protein interactions involving Tmem233, researchers should consider:

• Specificity controls: Include negative controls (unrelated transmembrane proteins) to confirm interaction specificity. For example, demonstrating that ExTxA specifically binds to TMEM233 but not to other membrane proteins .

• Quantification methods: For binding studies, quantify interaction strength using techniques such as ELISA or surface plasmon resonance, reporting binding affinities where possible.

• Localization analysis: When using imaging to assess co-localization, employ quantitative colocalization metrics (Pearson's correlation coefficient, Mander's overlap coefficient) rather than relying solely on visual assessment.

• Domain mapping: Determine which specific domains of TMEM233 are involved in the interaction through truncation or mutation studies. Given the single transmembrane topology of TMEM233, consider how the extracellular C-terminus might be involved in interactions with toxins like ExTxA .

• Native vs. recombinant context: Compare interaction data obtained using recombinant proteins with those from native tissue to verify physiological relevance.

How can researchers distinguish between direct and indirect effects of Tmem233 on channel function?

Distinguishing between direct and indirect effects of Tmem233 on channel function requires a multi-faceted experimental approach:

• Co-immunoprecipitation studies: Determine whether TMEM233 physically interacts with Na₍v₎ channels by performing co-immunoprecipitation from both heterologous expression systems and native tissues.

• Proximity labeling techniques: Methods such as BioID or APEX2 can identify proteins in close proximity to TMEM233 in living cells, helping to map the interaction network.

• Electrophysiology with channel mutants: Test whether specific mutations in Na₍v₎ channels affect TMEM233-dependent modulation to identify critical interaction sites.

• Time-resolved measurements: Examining the kinetics of TMEM233-induced changes can help distinguish between direct effects (typically rapid) and indirect effects mediated by signaling cascades (typically slower).

• Reconstitution experiments: Purified protein reconstitution in artificial membrane systems can provide strong evidence for direct interactions if channel modulation is preserved in this minimal system.

By systematically addressing these aspects, researchers can build a comprehensive model of how TMEM233 influences Na₍v₎ channel function, distinguishing between direct physical modulation and effects mediated through additional partners or signaling pathways.