Recombinant Mouse Transmembrane protein 234 (Tmem234)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Tmem234; Transmembrane protein 234
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-140
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Tmem234
Target Protein Sequence
MAASWGQVLALVLVAALWGGTQPLLKRASSGLEQVRERTWAWQLLQEIKALFGNTEYLMP FLLNQSGSLLYYLTLASTDLTLAVPICNSLAIVFTLIVGKVLGEDIGGKEAVAGMVLTIT GITVCITSSVSKTQGQPSHS
Uniprot No.

Target Background

Database Links

KEGG: mmu:76799

UniGene: Mm.293096

Protein Families
TMEM234 family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is Tmem234 and what is its primary function in mice?

Tmem234 (Transmembrane protein 234) is a membrane-associated protein predicted to have a hairpin structure with both C- and N-terminal parts extending toward the extracellular space. Studies in model organisms suggest that Tmem234 plays a critical role in maintaining the integrity of the glomerular filtration barrier in the kidney .

Based on functional studies in zebrafish and cross-species homology, mouse Tmem234 is likely involved in podocyte-glomerular basement membrane (GBM) adhesion. The protein is highly expressed in podocytes, particularly in foot processes, where it appears to be a component of the basal plasma membrane domain .

What is the genomic organization and conservation of Tmem234?

Tmem234 belongs to the putative transmembrane family 234 (IPR018908) . The human ortholog TMEM234 is located on chromosome 1 (1p35.2) and contains 12 exons . The protein sequence identity between zebrafish and human Tmem234 proteins is 52%, indicating significant evolutionary conservation . This conservation suggests functionally important roles across vertebrate species.

Species ComparisonProtein Sequence Identity to Human
Mouse29%
Rat29%
Zebrafish52%

Table 1: Cross-species conservation of Tmem234 compared to human ortholog

What expression patterns does Tmem234 show in kidney tissue?

RT-PCR and immunofluorescence analyses have shown that Tmem234 is highly enriched in glomerular podocytes. In adult kidney sections, strong glomerular immunoreactivity is observed with only weak signals detected in the rest of the kidney. Double labeling with podocyte markers has demonstrated that Tmem234 colocalizes with nephrin (a foot process marker) but not with markers for mesangial or glomerular endothelial cells .

These expression patterns suggest that Tmem234 has podocyte-specific functions, particularly in the foot processes that form the glomerular filtration barrier.

What methodologies are effective for studying Tmem234 function in kidney podocytes?

Methodological approach:

  • Immunolocalization studies: Use double-labeling immunofluorescence with established podocyte markers (nephrin for foot processes, vimentin for major processes) to determine precise subcellular localization. Combine with super-resolution microscopy for detailed structural insights .

  • In vivo knockdown models: Morpholino-based knockdown in zebrafish has provided valuable insights into Tmem234 function. Two different morpholinos targeting different parts of the Tmem234 gene (I1E2 and E1I1) have been successfully used to generate knockdown phenotypes, with I1E2 producing more pronounced effects .

  • Functional filtration assays: Filtration capacity can be assessed using fluorescently labeled dextrans of different molecular weights (e.g., FITC-labeled 500-kDa dextran with rhodamine-labeled 10-kDa dextran as a positive control). This methodology was effective in demonstrating compromised filtration in Tmem234 morphants .

  • Electron microscopy: Ultrastructural analysis using electron microscopy is essential for examining foot process morphology and identifying foot process effacement associated with Tmem234 deficiency .

  • Cross-species rescue experiments: To validate specificity of knockdown phenotypes and conservation of function, rescue experiments using mouse Tmem234 mRNA in zebrafish morphants have been successful, with 81% of embryos expressing GFP compared to 42% in non-rescued morphants .

How can I design effective knockdown/knockout experiments for mouse Tmem234?

When designing knockdown or knockout experiments for mouse Tmem234, consider the following methodological approaches:

  • Morpholino design for transient knockdown: Based on successful zebrafish studies, design morpholinos targeting splice junctions. Two effective targets from zebrafish studies included:

    • I1E2 morpholino targeting the intron 1-exon 2 boundary

    • E1I1 morpholino targeting the exon 1-intron 1 boundary

  • Validation controls: Include appropriate controls to rule out off-target effects:

    • Co-inject with p53 morpholino to control for p53-mediated off-target effects

    • Use multiple morpholinos targeting different regions of the gene

    • Perform rescue experiments with mouse Tmem234 mRNA to confirm specificity

  • Phenotypic assessment:

    • For kidney-specific studies, examine:

      • Podocyte morphology using podocyte-specific GFP expression

      • Filtration barrier integrity using dextran filtration assays

      • Ultrastructural changes via electron microscopy

      • Quantify cell numbers in glomeruli manually

  • qPCR primer design: For validating knockdown efficiency, design primers specific to mouse Tmem234. Based on successful primers in other species, consider targeting conserved regions. Example qPCR primer design approach from zebrafish studies:

    • Forward: 5′-GTGCCTGTGGTCAACTCCCT-′3

    • Reverse: 5′-aatgccgtgcgtctcagaga-′3

What phenotypes are associated with Tmem234 deficiency, and how can I characterize them?

Based on zebrafish studies, Tmem234 deficiency results in several phenotypes that can be characterized using the following methodological approaches:

  • Glomerular filtration barrier dysfunction:

    • Assessment method: Inject fluorescently labeled dextrans of different molecular weights (10-kDa and 500-kDa) into the circulatory system and monitor tubular fluorescence.

    • Expected phenotype: Presence of high molecular weight (500-kDa) dextran in tubules indicates compromised filtration barrier integrity.

    • Quantification: Percentage of larvae showing 500-kDa dextran in pronephric tubules (63% in Tmem234 morphants vs. 0% in controls) .

  • Podocyte structural abnormalities:

    • Assessment method: Electron microscopy of glomerular structure.

    • Expected phenotype: Foot process effacement while slit diaphragms, GBM, and endothelial cells appear unaffected.

    • Additional method: In transgenic lines with podocyte-specific GFP expression, monitor decreased GFP signal (42% vs. 93% in controls) .

  • Glomerular cell reduction:

    • Assessment method: Manual counting of cells in the pronephric glomerulus.

    • Expected phenotype: Significant reduction in glomerular cell number .

  • Developmental phenotypes:

    • Assessment method: Morphological assessment at different developmental stages.

    • Expected phenotype: Pericardial edema (mild to severe) .

PhenotypeTmem234 morphantsControl larvaeAssessment method
GFP-positive podocytes42 ± 2%93 ± 5%Fluorescence microscopy
500-kDa dextran in tubules63%0%Dextran filtration assay
Foot process effacementPresentAbsentElectron microscopy
Pericardial edemaPresentAbsentMorphological assessment

Table 2: Quantitative comparison of phenotypes between Tmem234-deficient and control organisms

How does the mouse recombinant Tmem234 protein compare with human TMEM234, and what applications exist for cross-species studies?

Mouse Tmem234 shows approximately 29% protein sequence identity with human TMEM234, while maintaining functional conservation . This enables several research applications:

  • Cross-species rescue experiments: Mouse Tmem234 mRNA can rescue phenotypes in zebrafish Tmem234 morphants, validating the orthology between mouse and zebrafish Tmem234 proteins. The expression of GFP was restored in 81% of embryos co-injected with mouse Tmem234 mRNA compared to 42% in non-rescued morphants .

  • Blocking experiments: Human TMEM234 control fragments (such as aa 105-158) can be used in blocking experiments with corresponding antibodies. The recommended protocol involves:

    • Using a 100x molar excess of the protein fragment control based on concentration and molecular weight

    • Pre-incubating the antibody-protein control fragment mixture for 30 minutes at room temperature before application in IHC/ICC and WB experiments

  • Antibody validation: When developing antibodies against mouse Tmem234, cross-reactivity with human TMEM234 should be assessed to determine species specificity and potential for translational applications .

  • Structure-function studies: Despite only 29% sequence identity, the functional conservation between mouse and human proteins suggests conservation of critical domains. Comparative analysis of these domains can inform structure-function relationships .

What are the current hypotheses regarding Tmem234 function in podocyte-GBM adhesion, and how can these be tested?

Current evidence suggests Tmem234 may be involved in podocyte-GBM adhesion based on several observations from zebrafish studies:

  • Subcellular localization: Tmem234 is located at the basal aspects of prepodocytes and not between cells where developing slit diaphragms are found, suggesting it functions at the interface between podocytes and the GBM .

  • Phenotypic similarity: The impairment of podocyte-GBM adhesion via integrins results in foot process effacement and proteinuria, a phenotype similar to that observed in Tmem234 morphants .

Methodological approaches to test this hypothesis:

  • Co-immunoprecipitation studies: To identify potential interactions between Tmem234 and known adhesion proteins:

    • Use anti-Tmem234 antibodies to pull down protein complexes from glomerular lysates

    • Analyze precipitated proteins for the presence of integrin subunits and other adhesion molecules

    • Confirm interactions through reverse co-immunoprecipitation

  • Proximity labeling techniques:

    • Express Tmem234 fused to a promiscuous biotin ligase (BioID or TurboID)

    • Identify proteins in physical proximity to Tmem234 through streptavidin pulldown and mass spectrometry

    • Validate candidates through co-localization studies

  • In vitro adhesion assays:

    • Develop cell lines with modulated Tmem234 expression

    • Measure adhesion strength to GBM components (laminin, collagen IV, etc.)

    • Compare wild-type versus knockdown/knockout cells

  • Domain mutation studies:

    • Generate constructs with mutations in specific Tmem234 domains

    • Test their ability to rescue knockdown phenotypes in zebrafish

    • Correlate functional rescue with adhesion capacity

What are the best practices for validating anti-Tmem234 antibodies for research applications?

Proper validation of anti-Tmem234 antibodies is crucial for obtaining reliable research results. The following methodological approach is recommended:

  • Blocking experiments: Use recombinant Tmem234 protein fragments to confirm antibody specificity:

    • Pre-incubate antibody with a 100x molar excess of recombinant protein control fragment

    • Compare staining patterns between blocked and unblocked antibody samples in IHC/ICC and WB applications

    • Observe elimination or significant reduction of signal in pre-blocked samples

  • Multiple antibody validation: Use multiple antibodies targeting different epitopes of Tmem234:

    • Compare staining patterns across antibodies

    • Consistent localization suggests specificity

  • Knockdown/knockout controls: The most stringent validation comes from using genetic models:

    • Test antibodies on tissues from Tmem234 knockdown/knockout models

    • Absence or significant reduction of signal confirms specificity

  • Cross-species reactivity: Determine antibody cross-reactivity with Tmem234 orthologs:

    • Test on samples from different species (mouse, human, zebrafish)

    • Especially important when translating findings across model systems

  • Subcellular localization consistency: Verify that observed localization is consistent with predicted protein structure:

    • Membrane localization expected for transmembrane proteins

    • Particular subcellular patterns (e.g., basal podocyte membrane) should be reproducible

How can I design experiments to investigate potential disease associations of Tmem234 mutations?

To investigate potential disease associations of Tmem234 mutations, consider the following experimental design approaches:

  • Genetic screening in patient cohorts:

    • Sequence Tmem234 in patients with unexplained proteinuria or kidney disease

    • Focus particularly on patients with foot process effacement

    • Compare variant frequencies with population databases

    • Perform segregation analysis in familial cases

  • Functional validation of identified variants:

    • Generate zebrafish or mouse models expressing variants of interest

    • Use CRISPR/Cas9 to introduce specific mutations

    • Assess phenotypes as described in section 2.3

    • Perform rescue experiments with wild-type Tmem234

  • Structure-function analysis:

    • Prioritize variants disrupting conserved domains

    • Map mutations onto predicted protein structure

    • Focus on mutations affecting membrane topology or protein-protein interaction sites

  • Cell-based assays:

    • Express wild-type and mutant Tmem234 in cultured podocytes

    • Assess effects on cell adhesion, morphology, and cytoskeletal organization

    • Examine protein localization and trafficking

  • Cancer association studies:

    • Analyze COSMIC database for somatic mutations in Tmem234

    • Correlate mutations with cancer types and clinical outcomes

    • Investigate effects on cell proliferation and migration in appropriate cell lines

What are the current gaps in our understanding of Tmem234 biology?

Several significant knowledge gaps remain in Tmem234 biology that represent promising areas for future research:

  • Protein interaction network: While Tmem234 is predicted to be involved in podocyte-GBM adhesion, its direct binding partners and interaction network remain largely unknown .

  • Regulatory mechanisms: The factors controlling Tmem234 expression during development and in response to injury are poorly characterized .

  • Tissue-specific functions: Although research has focused on kidney podocytes, comprehensive tissue expression data and potential functions in other organs remain to be elucidated .

  • Post-translational modifications: Information about how Tmem234 activity might be regulated through phosphorylation, glycosylation, or other modifications is lacking .

  • Role in disease pathogenesis: Beyond the experimental knockdown phenotypes, the contribution of Tmem234 variations to human kidney diseases requires further investigation .

How can advanced technologies be applied to further elucidate Tmem234 function?

Several cutting-edge technologies can be applied to advance our understanding of Tmem234:

  • Single-cell transcriptomics:

    • Profile Tmem234 expression at single-cell resolution across kidney development

    • Identify co-expressed gene networks to infer function

    • Compare expression patterns in healthy versus diseased kidneys

  • Cryo-electron microscopy:

    • Determine the precise structure of Tmem234 in membranes

    • Identify structural features that might mediate protein-protein or protein-lipid interactions

  • Super-resolution microscopy:

    • Visualize Tmem234 localization at nanometer resolution

    • Determine its precise distribution relative to other podocyte structures

    • Track dynamic behavior in live cells

  • Proteomics approaches:

    • Use proximity labeling (BioID/TurboID) to identify proteins in the vicinity of Tmem234

    • Perform quantitative proteomics on Tmem234 knockdown models to identify dysregulated pathways

    • Apply crosslinking mass spectrometry to identify direct binding partners

  • Genome-wide CRISPR screens:

    • Identify genes that modify Tmem234 phenotypes

    • Discover synthetic lethal interactions

    • Map genetic pathways upstream and downstream of Tmem234

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.