Recombinant Mouse Transmembrane protein 242 (Tmem242)

Shipped with Ice Packs
In Stock

Description

General Information

Proteins found in cell membranes are known as transmembrane proteins (TMEMs) . Transmembrane protein 242 (TMEM242) is a protein that has been identified in various organisms, including humans, mice, and zebrafish . TMEM242 is involved in various cellular processes, such as immune response, coagulation, and assembly of mitochondrial ATP synthase .

Role in Mitochondrial ATP Synthase Assembly

TMEM242 acts as a scaffold protein involved in the assembly of the c-ring of mitochondrial ATP synthase (F1F0 ATP synthase or complex V) . Human TMEM242, along with TMEM70, assists in assembling the rotor ring of human ATP synthase and interacts with assembly factors for complex I . Studies indicate that when TMEM242 is absent in human cells, it can impair ATP synthase assembly, leading to elevated levels of reactive oxygen species (ROS) .

Impact on Coagulation and Hemostasis

Research in zebrafish has shown that knockdown of tmem242 leads to increased bleeding, suggesting its involvement in hemostasis . Although thrombocyte production and aggregation remain unaffected, coagulation is impaired, resulting in delayed fibrin and thrombus formation . The depletion of tmem242 may impair ATP synthase, elevate ROS, and upregulate sirt6 and nrf2, which increases f9a transcripts and potentially leads to bleeding tendencies similar to disseminated intravascular coagulation (DIC) .

Influence on Immune Responses

Studies in mice have indicated that transmembrane protein 268 (TMEM268) interacts with CD11b and inhibits its degradation via the endosome-lysosome pathway, which reveal a positive regulatory role of TMEM268 in β2 integrin-associated anti-infectious immune responses . TMEM268 is a tumor growth-related protein that interacts with the integrin subunit β4 (ITGB4) and plays a positive role in the regulation of the ITGB4/PLEC signaling pathway . Tmem268 knockout in mice aggravated sepsis, with higher bacterial burden in tissues and organs . TMEM268 deficiency inhibited phagocyte adhesion and migration, decreasing phagocyte infiltration at the site of infection and complement-dependent phagocytosis .

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks to ensure fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Tmem242; Transmembrane protein 242
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-140
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Tmem242
Target Protein Sequence
METSGPGPGESSELEAPGSPDDRLFLVKGGIFLGSAAAAGMLAGFVTTLSLAKKKSPEWF NKGTMATAALPESGSSLALRALGWGSLYAWCGVGVISFAVWKALGVHSMKDFRSKMQSIF PPIPKNHESAEEWEEVLKWK
Uniprot No.

Target Background

Database Links

KEGG: mmu:70544

UniGene: Mm.46654

Protein Families
TMEM242 family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is the basic structure and function of Tmem242?

Tmem242 is a transmembrane protein encoded by the Tmem242 gene (also known as 1110008A10Rik, 2310046K16Rik, or 5730437N04Rik in mice). The protein contains a DUF1358 domain (Domain of Unknown Function 1358) and has two predicted transmembrane α-helices. Its primary function involves assisting in the assembly of the rotor ring (c8-ring) of ATP synthase in the inner mitochondrial membrane . The protein is relatively small, with the human ortholog being 141 amino acids in length, and mouse Tmem242 having a similar structure .

How is Tmem242 evolutionarily conserved across species?

Tmem242 demonstrates significant evolutionary conservation across metazoan species, with orthologs identified in organisms ranging from humans (H. sapiens) to chimpanzees (P. troglodytes), mice (M. musculus), rats (R. norvegicus), dogs (C. lupus), and zebrafish (Danio rerio) . This high degree of conservation suggests an essential biological function. The evolutionary divergence of species containing Tmem242 orthologs has been traced back approximately 794 million years, indicating that this protein has been maintained throughout significant evolutionary time .

What is known about the cellular localization of Tmem242?

Tmem242 is exclusively localized to the mitochondria, specifically as an integral component of the inner mitochondrial membrane (IMM). Studies using alkaline pH washing and detergent extraction have confirmed its membrane integration profile, showing resistance to alkaline extraction but susceptibility to extraction with deoxycholate concentrations of 0.5% or greater . Topological analyses using trypsinolysis of intact and lysed mitochondria have determined that both the N- and C-terminal regions of Tmem242 are oriented toward the mitochondrial matrix, with the loop connecting the two transmembrane helices facing the intermembrane space .

What expression systems are most effective for producing recombinant mouse Tmem242?

For recombinant mouse Tmem242 expression, researchers have successfully utilized multiple systems including E. coli, yeast, baculovirus-infected insect cells, mammalian cell expression, and cell-free expression systems . The choice of expression system depends on experimental requirements:

  • Cell-free expression systems: Ideal for rapid production and when post-translational modifications are not critical

  • E. coli: Suitable for producing large quantities of protein, though proper folding of transmembrane domains may be challenging

  • Mammalian cells: Provide the most physiologically relevant post-translational modifications and folding environment, especially important for functional studies

When selecting an expression system, consider whether native conformation and post-translational modifications are essential for your experimental questions .

What purification strategies yield the highest purity of recombinant Tmem242?

Effective purification of recombinant Tmem242 typically employs affinity chromatography utilizing epitope tags (commonly Strep II, FLAG, or His tags). Standard purification protocols can achieve ≥85% purity as determined by SDS-PAGE . For optimal results, consider the following methodology:

  • Initial extraction using mild detergents (0.5-1% deoxycholate or equivalent) to solubilize the membrane-integrated protein

  • Affinity chromatography using the appropriate resin for the incorporated tag

  • Size exclusion chromatography to separate monomeric Tmem242 from aggregates or incomplete translation products

  • Quality assessment via SDS-PAGE and Western blotting

For functional studies, detergent selection is critical as it must maintain protein structure while effectively solubilizing the membrane protein .

How can researchers effectively verify the expression and subcellular localization of Tmem242?

Verification of Tmem242 expression and localization requires a multi-faceted approach:

  • Western blotting: Using antibodies against Tmem242 or epitope tags to confirm expression and molecular weight

  • Subcellular fractionation: Isolating mitochondria and comparing against other cellular fractions to verify exclusive mitochondrial localization

  • Immunofluorescence microscopy: Co-staining with mitochondrial markers (such as MitoTracker) confirms mitochondrial localization

  • Protease protection assays: Using trypsinolysis of intact and lysed mitochondria to determine topology (N- and C-termini in the matrix)

  • Alkaline extraction: Differentiating between peripheral and integral membrane proteins

Researchers have successfully employed these techniques to establish that Tmem242 is an integral IMM protein with its terminals facing the matrix compartment .

What is the specific role of Tmem242 in ATP synthase assembly?

Tmem242 plays a critical role in the assembly of the ATP synthase complex, particularly in the formation of the c8-ring component of the rotor. The detailed functional mechanism involves:

  • Direct interaction with subunit c of ATP synthase, forming high molecular mass complexes in the range of 60-150 kDa

  • Coordination with another assembly factor, TMEM70, in facilitating c8-ring assembly

  • Influence on the incorporation of additional subunits (ATP6, ATP8, j, and k) into the ATP synthase complex

Unlike TMEM70, which primarily affects c8-ring assembly, Tmem242 has a broader influence on ATP synthase assembly, affecting the levels of subunits ATP6, ATP8, j, and k in the complex. This suggests that Tmem242 not only participates in c8-ring formation but also contributes to the terminal steps of ATP synthase assembly .

How does Tmem242 interact with other proteins in the mitochondrial inner membrane?

Tmem242 demonstrates selective interaction with specific proteins:

  • Primary interaction with ATP synthase subunit c: Forms complexes ranging from 60-150 kDa

  • Functional overlap with TMEM70: Both proteins interact with subunit c and contribute to c8-ring assembly, though their functions are not identical

  • Indirect influence on ATP6, ATP8, j, and k subunits: Depletion of Tmem242 reduces the levels of these subunits in ATP synthase complexes

These interactions appear to be highly specific, as Tmem242 selectively binds to subunit c from among the 18 types of subunits present in ATP synthase. The protein does not form the very large complexes (>150 kDa) observed with TMEM70, suggesting distinct assembly roles despite functional overlap .

What experimental approaches can distinguish between the roles of Tmem242 and TMEM70?

To differentiate between the functions of Tmem242 and TMEM70, researchers can employ several methodological approaches:

  • Sequential knockout/knockdown experiments:

    • Single knockout of each protein

    • Double knockout to assess synergistic effects

    • Rescue experiments with one protein in the absence of the other

  • Comparative biochemical analysis:

    • BN-PAGE (Blue Native-PAGE) to analyze the composition of ATP synthase subcomplexes in each knockout condition

    • Co-immunoprecipitation to identify differential protein interactions

    • Pulse-chase experiments to track the assembly kinetics in the absence of each protein

  • Structural analysis:

    • Crosslinking studies to map interaction domains

    • Mutagenesis of specific domains to identify functional regions

Studies have revealed that while both proteins influence c8-ring assembly, Tmem242 has additional effects on the incorporation of subunits ATP6, ATP8, j, and k, distinguishing its role from that of TMEM70 .

What phenotypic effects result from Tmem242 depletion in experimental models?

Depletion of Tmem242 in experimental models produces distinct phenotypic consequences related to mitochondrial function:

  • Reduced ATP synthase assembly: The most immediate effect is decreased formation of fully assembled ATP synthase complexes

  • Altered mitochondrial morphology: Changes in cristae structure may occur due to the role of ATP synthase in maintaining mitochondrial membrane architecture

  • Bioenergetic deficits: Reduced ATP production capacity affects energy-dependent cellular processes

  • Tissue-specific effects: Given the differential expression of Tmem242 across tissues (highest in brain, heart, adrenal, and thyroid), depletion effects may vary by tissue type

The severity of these phenotypes can be partially mitigated by the presence of TMEM70, which provides some functional redundancy, though complete compensation is not observed .

How can researchers resolve contradictory data regarding Tmem242 function?

When facing contradictory results in Tmem242 research, implement the following methodological approaches:

  • Standardize experimental systems:

    • Use consistent cell lines or animal models

    • Standardize knockout/knockdown techniques

    • Control for genetic background effects

  • Employ multiple complementary techniques:

    • Combine genetic approaches (CRISPR, RNAi) with biochemical analyses

    • Use both in vitro and in vivo systems to validate findings

    • Quantify protein levels with multiple methods (Western blot, mass spectrometry)

  • Consider tissue-specific effects:

    • Examine multiple tissues with varying Tmem242 expression levels

    • Account for compensatory mechanisms that may differ between tissues

  • Collaborate and replicate:

    • Engage independent laboratories to replicate key findings

    • Compare methodologies to identify sources of variability

These approaches help resolve apparent contradictions by identifying experimental variables that might influence outcomes .

What structural features of Tmem242 are critical for its function?

Critical structural features of Tmem242 include:

  • Two transmembrane α-helices: Essential for proper membrane insertion and orientation

  • N- and C-terminal regions: Located in the mitochondrial matrix, these regions likely mediate interactions with matrix components of ATP synthase

  • Intermembrane space loop: Connects the transmembrane helices and may facilitate interactions with intermembrane space proteins

  • DUF1358 domain: Though its specific function remains unknown, this domain is conserved across species, suggesting functional importance

The membrane topology of Tmem242 (N- and C-termini in the matrix) is opposite to that of the c-subunit of ATP synthase, potentially facilitating their interaction during assembly processes. This precise structural arrangement appears to be crucial for the protein's assembly function .

What are the most effective detection methods for analyzing Tmem242 in experimental samples?

For optimal detection of Tmem242 in experimental samples, researchers should consider these methodological approaches:

  • Western blotting:

    • Use antibodies against Tmem242 or epitope-tagged versions

    • Employ appropriate membrane protein extraction protocols with suitable detergents

    • Consider using gradient gels (10-20%) for better resolution of this small protein

  • Immunofluorescence microscopy:

    • Fix samples with paraformaldehyde to preserve membrane structures

    • Use confocal microscopy for precise colocalization with mitochondrial markers

    • Consider super-resolution techniques for detailed subcellular localization

  • Mass spectrometry:

    • Employ targeted proteomics approaches for quantitative analysis

    • Use crosslinking mass spectrometry to identify interaction partners

    • Consider SILAC or TMT labeling for comparative studies

  • Blue Native-PAGE:

    • Particularly useful for analyzing native protein complexes containing Tmem242

    • Enables visualization of the 60-150 kDa complexes formed with subunit c

These methods can be complemented with appropriate controls and validation techniques to ensure specificity and accuracy .

What experimental challenges arise when studying the interaction between Tmem242 and ATP synthase components?

Common experimental challenges and their solutions include:

  • Detergent sensitivity:

    • Challenge: Inappropriate detergents may disrupt native interactions

    • Solution: Screen multiple detergents (digitonin, DDM, Triton X-100) at varying concentrations to identify optimal conditions for maintaining interactions while solubilizing membrane proteins

  • Transient interactions:

    • Challenge: Assembly factor interactions may be transient and difficult to capture

    • Solution: Use crosslinking approaches or proximity labeling techniques (BioID, APEX) to capture transient interactions

  • Complex size heterogeneity:

    • Challenge: Tmem242-containing complexes vary in size (60-150 kDa)

    • Solution: Use gradient gel electrophoresis or size exclusion chromatography to separate and analyze different complex populations

  • Distinguishing direct from indirect effects:

    • Challenge: Determining whether Tmem242 directly or indirectly affects specific assembly steps

    • Solution: Perform in vitro reconstitution experiments with purified components to test direct interactions

These methodological considerations can help overcome the challenges inherent in studying membrane protein assembly factors .

How can researchers optimize expression systems for functional studies of recombinant Tmem242?

For functional studies of recombinant Tmem242, optimization of expression systems should consider:

  • Expression system selection:

    • Mammalian systems (HEK293, HeLa) provide the most physiologically relevant environment for mitochondrial proteins

    • Consider inducible expression systems to control expression levels

    • Use cell lines with endogenous Tmem242 knockout as backgrounds for rescue experiments

  • Construct design:

    • Include epitope tags (FLAG, Strep II) for detection and purification

    • Consider tag position carefully (N- versus C-terminal) to avoid interfering with function

    • Include appropriate mitochondrial targeting sequences if using heterologous systems

  • Expression conditions:

    • Optimize temperature and induction time to maximize proper folding

    • Consider mild induction to avoid overwhelming the mitochondrial import machinery

    • Monitor mitochondrial health during expression

  • Functional validation:

    • Confirm mitochondrial localization via fractionation and microscopy

    • Verify membrane integration using alkaline extraction

    • Assess rescue of phenotypes in Tmem242-deficient cells

Researchers have successfully used both C-terminal tagged (TMEM242-t) and N-terminal tagged (TMEM242-Nt) constructs in HEK293 and HeLa cells respectively, confirming correct mitochondrial localization and membrane integration .

What are the most promising approaches for resolving the structure of Tmem242?

Advanced structural biology approaches for Tmem242 include:

  • Cryo-electron microscopy (cryo-EM):

    • Suitable for membrane proteins without crystallization

    • Can capture Tmem242 in complex with assembly intermediates

    • Might require stabilization strategies (nanodiscs, amphipols)

  • NMR spectroscopy:

    • Particularly for specific domains or peptide fragments

    • Can provide dynamic information about protein movements

    • Requires isotope labeling (15N, 13C)

  • X-ray crystallography:

    • Challenging for membrane proteins but possible with proper detergent screening

    • May require fusion partners or antibody fragments for crystallization

    • Could provide atomic-level resolution

  • Computational modeling:

    • Homology modeling based on related proteins

    • Molecular dynamics simulations of membrane insertion

    • Machine learning approaches for structure prediction

These complementary approaches may collectively elucidate the structure-function relationship of Tmem242 in ATP synthase assembly .

How might Tmem242 function be relevant to mitochondrial disease mechanisms?

The potential relevance of Tmem242 to mitochondrial diseases stems from several factors:

  • ATP synthase assembly: Defects in ATP synthase assembly cause known mitochondrial diseases; Tmem242 dysfunction could contribute to similar pathologies

  • Tissue expression pattern: Tmem242's high expression in brain and heart correlates with tissues commonly affected in mitochondrial diseases

  • Interaction with disease-associated pathways: Tmem242's predicted interaction with MAP2K1IP1, which connects to the MAP Kinase pathway and potentially to Alzheimer's disease through Tau phosphorylation

  • Conservation across species: High evolutionary conservation suggests essential function

Research approaches to investigate disease relevance should include:

  • Screening for TMEM242 mutations in patients with unexplained mitochondrial disorders

  • Creating tissue-specific knockout models to assess organ-specific pathologies

  • Investigating potential links to neurodegenerative conditions through the MAP Kinase pathway connection

  • Examining interactions with known disease-associated ATP synthase subunits

What techniques can reveal the temporal dynamics of Tmem242 in ATP synthase assembly?

To investigate the temporal dynamics of Tmem242 in ATP synthase assembly:

  • Pulse-chase experiments:

    • Pulse-label newly synthesized proteins and track their incorporation into complexes over time

    • Use radioactive or non-radioactive labeling methods (SILAC, AHA)

    • Analyze samples at multiple time points by BN-PAGE or immunoprecipitation

  • Live-cell imaging:

    • Generate fluorescent protein fusions with Tmem242

    • Use photoactivatable or photoswitchable fluorescent proteins to track specific protein populations

    • Apply FRAP (Fluorescence Recovery After Photobleaching) to measure turnover rates

  • Time-resolved crosslinking:

    • Apply chemical crosslinkers at defined time points during assembly

    • Identify interaction partners by mass spectrometry

    • Map the sequence of protein-protein interactions during assembly

  • Single-molecule techniques:

    • Apply super-resolution microscopy to track individual molecules

    • Use FRET (Förster Resonance Energy Transfer) to monitor protein-protein interactions in real-time

These approaches can reveal how Tmem242 temporally coordinates with other assembly factors and ATP synthase subunits during the assembly process .

How does mouse Tmem242 differ from human TMEM242 in structure and function?

Mouse Tmem242 and human TMEM242 show high conservation but with subtle differences:

  • Sequence homology: While highly conserved, specific amino acid differences exist between species

  • Alternative gene names: Mouse Tmem242 is alternatively known as 1110008A10Rik, 2310046K16Rik, and 5730437N04Rik, reflecting differences in annotation history

  • Expression patterns: Both show high expression in brain, heart, adrenal, and thyroid tissues, but may have species-specific differences in expression levels

  • Functional conservation: Both participate in ATP synthase assembly, though subtle differences in efficiency or interaction partners may exist

Despite these differences, the fundamental role in ATP synthase assembly appears conserved between species, making mouse models valuable for studying TMEM242 function relevant to human biology .

What is the relationship between Tmem242 and other assembly factors in the ATP synthase assembly pathway?

Tmem242 functions within a network of assembly factors:

  • Relationship with TMEM70:

    • Both interact with subunit c and influence c8-ring assembly

    • Functions partially overlap but are not identical

    • TMEM70 primarily affects c8-ring assembly, while Tmem242 has broader effects

  • Sequential assembly pathway:

    • Tmem242 appears to influence both early (c8-ring formation) and later assembly steps

    • Affects incorporation of subunits ATP6, ATP8, j, and k

    • May coordinate with other assembly factors at different stages

  • Hierarchical relationships:

    • ATP synthase assembly follows a defined sequence of module addition

    • Tmem242 appears to function across multiple stages of this sequence

    • May serve as a bridging factor between early and late assembly processes

This complex network of interactions suggests that Tmem242 plays a multifaceted role in coordinating ATP synthase assembly, beyond a simple chaperone function .

What controls are essential when designing knockout or knockdown experiments for Tmem242?

Essential controls for Tmem242 knockout/knockdown experiments include:

  • Validation controls:

    • Confirm knockout/knockdown efficiency at both mRNA and protein levels

    • Verify specificity using rescue experiments with wild-type Tmem242

    • Include isogenic wild-type controls for accurate comparison

  • Functional controls:

    • Measure ATP synthase assembly and function

    • Assess mitochondrial membrane potential

    • Quantify ATP production capacity

  • Specificity controls:

    • Monitor levels of other assembly factors (especially TMEM70)

    • Assess effects on other mitochondrial complexes

    • Test for compensatory mechanisms (upregulation of related genes)

  • Temporal controls:

    • Use inducible systems to distinguish between developmental and acute effects

    • Perform time-course analyses after induction of knockout/knockdown

These controls help distinguish direct effects of Tmem242 depletion from secondary consequences or compensatory adaptations .

How can researchers design experiments to test the hypothesis that Tmem242 functions as a molecular chaperone?

To test Tmem242's potential chaperone function:

  • In vitro folding assays:

    • Assess whether purified Tmem242 prevents aggregation of denatured proteins

    • Test specific activity with ATP synthase subunits versus control proteins

    • Measure changes in folding kinetics in the presence of Tmem242

  • Binding studies:

    • Characterize interaction with folding intermediates versus mature proteins

    • Measure binding affinities under different conditions

    • Identify specific binding motifs or regions

  • ATP dependence:

    • Test whether Tmem242 function requires ATP hydrolysis

    • Assess ATPase activity of purified Tmem242

    • Create ATPase-deficient mutants and test functionality

  • Structural studies:

    • Identify potential substrate-binding domains

    • Create domain deletion mutants to map functional regions

    • Use crosslinking to capture chaperone-substrate complexes

These approaches would provide evidence for or against a classical chaperone mechanism for Tmem242 in ATP synthase assembly .

What methodology would best detect subtle phenotypes in Tmem242-deficient models?

For detecting subtle phenotypes in Tmem242-deficient models:

  • High-resolution respirometry:

    • Measure oxygen consumption rates under various substrate conditions

    • Assess specific complex activities with inhibitor titrations

    • Evaluate coupling efficiency and proton leak

  • Metabolomic profiling:

    • Comprehensive analysis of metabolites using mass spectrometry

    • Focus on energy-related metabolites (ATP/ADP ratio, NAD+/NADH)

    • Monitor stress-related metabolic signatures

  • Stress challenge tests:

    • Expose cells/models to metabolic stressors (glucose deprivation, galactose media)

    • Test thermal or oxidative stress responses

    • Measure recovery kinetics after stress exposure

  • Tissue-specific analyses:

    • Focus on high-expression tissues (brain, heart, adrenal, thyroid)

    • Compare different cell types within these tissues

    • Conduct in vivo functional tests (exercise capacity, cognitive testing)

  • Multi-omics integration:

    • Combine transcriptomics, proteomics, and metabolomics

    • Apply pathway analysis to identify subtly affected processes

    • Use computational modeling to predict emergent phenotypes

These sensitive approaches can reveal phenotypes that might be missed by conventional assays, particularly under basal conditions where compensatory mechanisms may mask defects .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.