Recombinant Mouse Transmembrane protein 246 (Tmem246)

Shipped with Ice Packs
In Stock

Description

Overview of Tmem246

While "Recombinant Mouse Transmembrane protein 246 (Tmem246)" is the subject of this article, it is important to note that the protein identified in the provided documents is Transmembrane protein 268 (TMEM268) . TMEM268 is a tumor growth-related protein that interacts with integrin subunit β4 (ITGB4) and regulates the ITGB4/PLEC signaling pathway .

TMEM268 and Immune Response

Tmem268 knockout in mice can worsen sepsis induced by cecal ligation and puncture, leading to a higher bacterial burden in tissues and organs, as well as congestion and apoptosis . TMEM268 deficiency in mice inhibits phagocyte adhesion and migration, reducing phagocyte infiltration at the site of infection and complement-dependent phagocytosis . TMEM268 interacts with CD11b and inhibits its degradation via the endosome–lysosome pathway, playing a positive regulatory role in β2 integrin-associated anti-infectious immune responses . Targeting the TMEM268–CD11b signaling axis may be valuable for maintaining immune homeostasis and for immunotherapy for sepsis and related immune disorders .

Mice lacking Tmem268 show increased bacterial burden in the lungs, liver, kidney, blood, and peritoneal cavity . They also exhibit higher serum levels of pro-inflammatory cytokines such as tumor necrosis factor (TNF)-α, IFN-β, and chemokine MCP-1/CCL2 . These mice display severely damaged lung and kidney tissues and an increased number of apoptotic cells in lung tissue .

Experiments using bone marrow chimeras indicate that both stromal and hematopoietic TMEM268 are required for antibacterial defense . Macrophage depletion in Tmem268 CLP mice still results in a higher bacterial load than in −/− Tmem268 CLP mice . Tmem268 BMDMs exhibit a lower phagocytosis index than −/− Tmem268 BMDMs in the presence of RFP- E. coli opsonized by IgG-free serum, suggesting that complement-mediated phagocytosis is decreased in +/+ Tmem268 macrophages .

TMEM246-AS1 and Kidney Cancer Prognosis

TMEM246-AS1, a long non-coding RNA (lncRNA), is found to be downregulated in kidney cancer samples and indicates a poor prognosis when lowly expressed, suggesting it acts as a protective factor when its gene expression is higher . TMEM246-AS1 gene expression is closely associated with gender, T, M, and stage of kidney cancer, with lower expression levels observed in male patients and those with advanced T, M, and stage kidney cancer .

TMEM246 and Acute Erythroid Leukemia (AEL)

In acute erythroid leukemia, overexpression of TMEM246 is observed in cases with NUP98 fusions or TP53 mutations . These cases also show overexpression of PLOD2, FREM1, and MECOM, along with low expression of DEFA1B and DEF4A, compared to other groups .

Supplementary Data

Since data tables were requested and the search results do not contain a table for Tmem246, information is provided below on similar proteins.

Multi-Omics Benchmarks

Multi-omics research combines two or more omics data sets to aid in data analysis .

Benchmark CategoryDescription
Multi-omics clustering algorithmsCompares different algorithms for clustering multi-omics data, using datasets like TCGA cancer data .
Multi-omics dimensionality reductionEvaluates methods for reducing the dimensionality of multi-omics data, again often using TCGA cancer data .
Multi-omics survival prediction methodsAssesses different methods for predicting survival outcomes based on multi-omics data, primarily using TCGA cancer data .

Recombinant Mouse CD6

Recombinant Mouse CD6 supports the adhesion of HuT 78 human cutaneous T cell lymphoma cells . The ED50 for this effect is 0.4-2.4 μg/mL .

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline for your preparation.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type will be determined during production. If you require a specific tag, please inform us, and we will prioritize its inclusion.
Synonyms
Pgap4; Tmem246; Post-GPI attachment to proteins factor 4; Post-GPI attachment to proteins GalNAc transferase 4; Transmembrane protein 246
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-403
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Tmem246
Target Protein Sequence
MTTSTSPAAMLLRRLRRLSWGSTAVQLFILTVVTFGLLAPLACHRLLHSYFYLRHWHLNQ MSQDFLQQSLKEGEAALHYFEELPSANGSVPIVWQATPRPWLVITIITVDRQPGFHYVLQ VVSQFHRLLQQCGPQCEGHQLFLCNVERSVSHFDAKLLSKYVPVANRYEGTEDDYGDDPS TNSFEKEKQDYVYCLESSLQTYNPDYVLMVEDDAIPEEQIFPVLEHLLRARFSEPHLQDA LYLKLYHPERLQHYINPEPMRILEWVGVGMLLGPVLTWIYMRFACRPGFSWPVMLFFCLY SMGLVELVGRHYFLELRRLSPSLYSVVPASQCCTPAMLFPAPAARRTLTYLSQVYCHKGF GKDMALYSLLRAKGERAYVVEPNLVKHIGLFSSLRYNFHPSLL
Uniprot No.

Target Background

Function
Recombinant Mouse Transmembrane protein 246 (Tmem246) is a Golgi-resident glycosylphosphatidylinositol (GPI)-N-acetylgalactosamine transferase. It participates in the lipid remodeling steps of GPI-anchor maturation, specifically generating two saturated fatty chains at the sn-2 position of GPI-anchored proteins. Tmem246 is essential for the initial step of GPI-GalNAc biosynthesis, transferring GalNAc to GPI within the Golgi apparatus following fatty acid remodeling by PGAP2.
Database Links

KEGG: mmu:67063

UniGene: Mm.454013

Protein Families
TMEM246 family
Subcellular Location
Golgi apparatus membrane; Multi-pass membrane protein.

Q&A

What is Transmembrane protein 246 (Tmem246) and its basic structural characteristics?

Transmembrane proteins are integral membrane proteins that span the entirety of the biological membrane. Transmembrane protein 246 belongs to the TMEM family, which generally functions as components of cellular membranes involved in various physiological processes. Similar to other transmembrane family members, Tmem246 likely contains hydrophobic domains that anchor it within the lipid bilayer. Transmembrane proteins typically feature extracellular domains, transmembrane segments, and cytoplasmic regions, each contributing to specific functions including signaling, transport, or enzymatic activities.

Like other members of the TMEM family, Tmem246 research would involve characterization of its amino acid sequence, identification of functional domains, and determination of membrane topology. For comparison, known transmembrane proteins like CD6 contain specific domains (such as the SRCR domains in CD6) that facilitate protein-protein interactions .

What expression patterns are typically observed for Tmem246 in mouse tissues?

When investigating expression patterns of transmembrane proteins like Tmem246, researchers typically employ techniques such as RT-qPCR, RNA-seq, and immunohistochemistry to determine tissue distribution. Many TMEM family proteins show tissue-specific expression patterns that correlate with their specialized functions.

For methodological approaches, researchers should isolate RNA from multiple tissue types, perform reverse transcription, and quantify expression levels using qPCR with gene-specific primers. Expression analysis should include normalization to housekeeping genes and statistical validation across biological replicates. Comparative analysis with other TMEM family members can provide additional context for understanding tissue-specific functions. For instance, other transmembrane proteins like CD6 show specific expression in thymocytes, T cells, B cell subsets, and certain brain regions .

How is recombinant Tmem246 typically produced and purified for research applications?

Production of recombinant transmembrane proteins presents unique challenges due to their hydrophobic nature. For Tmem246, researchers would typically clone the coding sequence into an expression vector containing an appropriate tag (such as His-tag) to facilitate purification. Expression systems commonly used include bacterial (E. coli), insect cells, or mammalian cells, with the latter two often preferred for transmembrane proteins to ensure proper folding and post-translational modifications.

For purification, a methodological approach similar to other transmembrane proteins would involve cell lysis under conditions that solubilize membrane proteins (using detergents like CHAPS, DDM, or Triton X-100), followed by affinity chromatography targeting the fusion tag. For instance, His-tagged proteins can be purified using immobilized metal affinity chromatography (IMAC). As seen with recombinant CD6, proteins may be formulated as lyophilized from a filtered solution in PBS and reconstituted at specific concentrations (e.g., 500 μg/mL) for experimental use .

What functional assays are most effective for characterizing Tmem246 activity in vitro?

Characterizing transmembrane protein function requires specialized assays that account for their membrane-associated nature. For Tmem246, researchers should consider multiple complementary approaches:

  • Protein-Protein Interaction Assays: Co-immunoprecipitation, proximity ligation assays, or FRET can identify binding partners. Similar to CD6's interaction with ALCAM (CD166), Tmem246 may have specific binding partners that mediate its biological functions .

  • Cell Adhesion Assays: If Tmem246 functions in cellular adhesion, researchers can immobilize the recombinant protein and measure adhesion of relevant cell types. This approach has been used with CD6, where immobilized recombinant protein supported adhesion of specific cell lines with a measurable ED50 (0.4-2.4 μg/mL) .

  • Signaling Pathway Analysis: Phosphorylation assays, reporter gene assays, and kinase activity measurements can determine if Tmem246 participates in signal transduction. Analysis of phosphorylation sites in the cytoplasmic domain and identification of interacting signaling molecules would be crucial, similar to how CD6 exhibits hyperphosphorylation of serine and threonine residues during T cell activation .

  • Functional Knockdown/Knockout Studies: siRNA, shRNA, or CRISPR-Cas9 approaches can assess the consequences of Tmem246 depletion. Growth competition assays using GFP-positive cells (similar to those used for TMEM244) could quantify effects on cell proliferation, and Annexin V/7AAD staining can determine if the protein affects apoptotic processes .

How does the subcellular localization of Tmem246 influence its functionality?

The precise subcellular localization of transmembrane proteins is critical for their function. For Tmem246, researchers should consider:

  • Methodological Approach to Localization: Combine subcellular fractionation with quantitative PCR and fluorescence in situ hybridization (FISH) to determine the distribution of Tmem246 mRNA. For protein localization, immunofluorescence microscopy using specific antibodies against Tmem246 or epitope tags in recombinant constructs would be essential.

  • Correlation with Function: Different cellular membrane systems (plasma membrane, endoplasmic reticulum, Golgi, endosomes) support distinct functions. Researchers should investigate whether Tmem246 localizes primarily to the plasma membrane (suggesting roles in cell-cell interaction, signal transduction, or transport) or to internal membranes (indicating roles in protein trafficking, organelle function, or intracellular signaling).

  • Dynamic Regulation: Examine whether stimuli or cellular conditions alter Tmem246 localization, suggesting regulated functions. For comparison, some TMEM family members show differential subcellular distribution patterns based on cellular conditions; TMEM244 transcript, for instance, shows predominantly cytoplasmic localization with partial nuclear presence .

What are the challenges in detecting alternative splice variants of Tmem246 and their functional implications?

Transmembrane proteins often exhibit alternative splicing, generating isoforms with potentially distinct functions. For Tmem246 research:

  • Identification Strategy: Employ RT-PCR with primers spanning exon junctions, followed by sequencing to identify alternative transcripts. RNA-Seq analysis with splice-junction aware algorithms can comprehensively identify variants across different tissues or conditions.

  • Quantitative Analysis: Design variant-specific qPCR assays to measure relative abundance of each isoform across tissues or experimental conditions. This approach has been successful in characterizing TMEM244 variants, where expression followed the pattern: variant1 > variant2 > variant3 > variant4 in most cell lines .

  • Functional Characterization: Express each variant individually in cellular models to determine differences in localization, interaction partners, or signaling capabilities. Structural predictions can identify how alternative splicing might affect protein domains and function.

  • Biological Significance: Investigate whether specific variants correlate with developmental stages, disease states, or responses to stimuli, which may indicate specialized functions for each isoform.

What quality control measures are critical for validating recombinant Tmem246 for research applications?

Ensuring the quality of recombinant transmembrane proteins is essential for reliable research outcomes. Key validation steps include:

Quality Control ParameterMethodologyAcceptance Criteria
Protein PuritySDS-PAGE with Coomassie staining>90% purity with correct band size
Identity ConfirmationWestern blot with specific antibodiesSingle band at expected molecular weight
Structural IntegrityCircular dichroism spectroscopyAppropriate secondary structure content
Functional ActivityBinding assays with known ligandsSpecific binding with expected affinity
Endotoxin LevelsLAL assay<1 EU/mg for cell-based applications
Aggregation StateSize exclusion chromatographyPredominantly monomeric or native oligomeric state

For recombinant transmembrane proteins, SDS-PAGE analysis under both reducing and non-reducing conditions is particularly informative, as demonstrated with CD6, which showed bands at 70-80 kDa under these conditions . Additionally, for carrier-free preparations (CF), confirmation of the absence of carrier proteins like BSA is important for applications where carrier proteins might interfere with experimental outcomes .

How can researchers effectively design knockdown/knockout studies to investigate Tmem246 function?

To investigate the physiological roles of Tmem246 through loss-of-function approaches:

  • Target Selection for RNA Interference: Design multiple shRNAs or siRNAs targeting different regions of the Tmem246 transcript. Test efficiency using qRT-PCR and/or Western blot to confirm knockdown at both RNA and protein levels.

  • Functional Validation: Implement GFP growth competition assays to measure effects on cell proliferation over time. This approach has been successful with TMEM244, where knockdown reduced the GFP-positive cell population by more than 50% compared to controls .

  • Mechanism Analysis: Combine knockdown with functional assays such as Annexin V/7AAD staining to determine if growth inhibition results from apoptosis or other mechanisms. While TMEM244 knockdown showed only slight increases in apoptotic cells in some cell lines, different transmembrane proteins may influence distinct cellular processes .

  • CRISPR-Cas9 Approach: For complete knockout studies, design guide RNAs targeting early exons of Tmem246 to ensure functional disruption. Verify knockout by sequencing and absence of protein expression, then perform comprehensive phenotypic analysis including proliferation, morphology, and relevant functional assays.

What are the optimal expression systems for producing functional recombinant Tmem246?

Selection of an appropriate expression system is critical for obtaining functional transmembrane proteins:

  • Mammalian Expression Systems: Often preferred for transmembrane proteins due to proper folding and post-translational modifications. HEK293 or CHO cells are commonly used, with transient or stable transfection approaches depending on yield requirements.

  • Insect Cell Systems: Baculovirus-infected Sf9 or High Five cells offer advantages of higher yields while maintaining most post-translational modifications. This system may be suitable for Tmem246 if mammalian-specific modifications are not critical.

  • Cell-Free Systems: For difficult-to-express transmembrane proteins, cell-free systems supplemented with lipids or detergents can be effective alternatives, allowing direct incorporation into artificial membrane environments.

  • Expression Tagging Strategy: Consider the impact of tag placement (N-terminal vs. C-terminal) on protein folding and function. For instance, C-terminal His-tags are commonly used for transmembrane proteins, as seen with recombinant mouse CD6 .

  • Solubilization and Purification: Optimize detergent types and concentrations for efficient extraction while maintaining protein structure and function. Stepwise detergent exchange during purification may improve protein stability.

How can Tmem246 research contribute to understanding disease mechanisms in mouse models?

Investigating Tmem246 in disease contexts may reveal important pathophysiological insights:

  • Expression Analysis in Disease Models: Quantify Tmem246 expression across tissues in mouse models of relevant diseases, particularly those affecting organs where Tmem246 is normally expressed. Correlate expression changes with disease progression or severity.

  • Genetic Manipulation in Disease Models: Generate conditional Tmem246 knockout mice to study its role in specific tissues or developmental stages. Cross these with disease model mice to determine if Tmem246 modulation affects disease onset, progression, or severity.

  • Therapeutic Potential: Assess whether targeting Tmem246 (through antibodies, small molecules, or genetic approaches) modifies disease outcomes in mouse models. For context, other transmembrane proteins like CD6 have been targeted therapeutically in immunosuppressive treatments for conditions like kidney or bone marrow allograft rejection .

  • Biomarker Development: Evaluate whether Tmem246 expression or localization patterns correlate with disease states, potentially serving as diagnostic or prognostic biomarkers. Similar approaches have been successful with TMEM244, which has been identified as a diagnostic marker for Sézary syndrome .

What computational approaches can predict Tmem246 structure-function relationships?

Computational methods offer valuable insights when experimental structural data is limited:

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.