Recombinant Mouse Transmembrane protein 33 (Tmem33)

Shipped with Ice Packs
In Stock

Description

Introduction

Transmembrane protein 33 (Tmem33), also known as SHINC-3, is a protein found in the endoplasmic reticulum (ER) that plays a role in the unfolded protein response (UPR) . The UPR is a cellular stress response that is activated when the ER is under stress, which can be caused by a variety of factors, including viral infection, nutrient deprivation, and toxins . During ER stress, Tmem33 modulates the PERK-eIE2α-ATF4 and IRE1-XBP1 axes of the UPR signaling pathways .

Structure and Function

Tmem33 is an ER transmembrane molecule that binds to PERK (protein kinase RNA-like endoplasmic reticulum kinase) . It is expressed in various human tissues and cancer cell lines . Tmem33 appears to be localized to the ER, as demonstrated by immunofluorescence and biochemical fractionation analyses .

Role in Unfolded Protein Response

ER stress activates the UPR signaling cascade, potentially leading to apoptotic cell death, autophagy, oncogenesis, metastasis, or resistance to cancer therapies . Tmem33 influences the UPR by interacting with PERK and IRE1α (inositol-requiring enzyme 1 alpha) . Overexpression of Tmem33 increases the expression of p-eIF2α (phosphorylated eukaryotic translation initiation factor 2 alpha) and p-IRE1α (phosphorylated inositol-requiring enzyme 1 alpha), as well as their downstream effectors, ATF4-CHOP (activating transcription factor 4-CCAAT-enhancer-binding protein homologous protein) and XBP1-S (X-box binding protein 1 spliced), respectively, in breast cancer cells . Tmem33 overexpression also correlates with increased expression of apoptotic signals, such as cleaved caspase-7 and cleaved PARP (poly (ADP-ribose) polymerase), the autophagosome protein LC3II, and reduced expression of the autophagy marker p62 .

Implications in Disease

Tmem33 may function as a determinant of ER stress-responsive events in cancer cells . It also appears to be crucial for all life cycle stages of the malaria parasite, making it a potential antimalarial target .

Experimental Data

Experiment TypeMethodResults
Expression AnalysisImmunoblotting and Northern BlottingER stress increases TMEM33 expression levels in various cell lines .
Subcellular LocalizationImmunofluorescence and Subcellular FractionationTMEM33 is localized to the endoplasmic reticulum .
Binding Partner IdentificationImmunoprecipitationTMEM33 binds to PERK .
Downstream Effector AnalysisImmunoblottingExogenous expression of TMEM33 increases the expression of p-eIF2α and p-IRE1α and their known downstream effectors, ATF4-CHOP and XBP1-S, respectively, in breast cancer cells. TMEM33 overexpression also correlates with increased expression of apoptotic signals including cleaved caspase-7 and cleaved PARP .

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and agreed upon in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type will be determined during the production process. If you require a specific tag, please inform us; we will prioritize developing the specified tag.
Synonyms
Tmem33; Db83; Transmembrane protein 33; Protein DB83
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-247
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Tmem33
Target Protein Sequence
MADTTPNGPQGAGAVQFMMTNKLDTAMWLSRLFTVYCSALFVLPLLGLHEAASFYQRALL ANALTSALRLHQRLPHFQLSRAFLAQALLEDSCHYLLYSLIFVNSYPVTMSIFPVLLFSL LHAATYTKKVLDAKGSNSLPLLRSFLDKLSTNQQNILKFIACNEIFLMPATVFMLFSGQG SLLQPFIYYRFLTLRYSSRRNPYCRNLFNELRIVVEHIIMKPSCPLFVRRLCLQSIAFIS RLAPTVA
Uniprot No.

Target Background

Function
Recombinant Mouse Transmembrane protein 33 (Tmem33) acts as a regulator of the tubular endoplasmic reticulum (ER) network. It suppresses RTN3/4-induced ER tubule formation and positively regulates both PERK-mediated and IRE1-mediated unfolded protein response signaling.
Database Links

KEGG: mmu:67878

UniGene: Mm.23217

Protein Families
PER33/POM33 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein. Melanosome. Nucleus envelope.

Q&A

What is the subcellular localization pattern of TMEM33 throughout different developmental stages?

TMEM33 primarily localizes to the endoplasmic reticulum (ER) membrane. Studies using C-terminal tagged TMEM33 have demonstrated consistent ER localization throughout blood and mosquito stages of parasite development . In mammalian cells, TMEM33-GFP shows clear co-localization with ER-specific markers such as ER tracker . Importantly, while TMEM33 is present at the ER, it is notably absent from the primary cilium in renal tubular epithelial cells, despite the presence of its interaction partner PC2 at this location . This distinct localization pattern suggests specialized functions of TMEM33 that are restricted to the ER compartment.

What are the key structural domains of mouse TMEM33 protein and how do they contribute to its function?

Mouse TMEM33 contains three conserved transmembrane domains which anchor it to the ER membrane. The protein's N and C termini are both predicted to face the cytosolic side , although alternative topologies have been proposed. Interaction studies reveal that:

  • The C-terminus of TMEM33 interacts with the N-terminus of PC2

  • The N-terminus of TMEM33 interacts with the C-terminus of PC2

  • TMEM33 forms a complex with RNF5 (an E3 ubiquitin ligase) and SCAP to regulate lipid homeostasis

Truncation experiments demonstrate that partial removal of the PC2 C-terminal domain reduces its interaction with TMEM33, indicating specific domain-domain interactions between these proteins .

How is TMEM33 expression regulated across different tissue types and disease states?

  • TMEM33 is upregulated in 24 out of 33 cancer types compared to normal tissues

  • In cervical cancer specifically, TMEM33 shows:

    • Higher expression in adenosquamous compared to squamous cell carcinoma

    • Significant correlation with height, N stage, and histological type

    • Area under ROC curve of 0.881 for cervical cancer diagnosis, indicating high sensitivity and specificity

TMEM33 is also a stress-inducible protein, with its expression increasing under ER stress conditions .

What are the recommended specifications for working with recombinant mouse TMEM33 protein?

Based on commercially available recombinant mouse TMEM33 protein, researchers should consider the following specifications:

ParameterSpecification
SourceMammalian Cells
TagHis
FormLiquid or lyophilized powder
Endotoxin< 1.0 EU per μg of protein (LAL method)
Purity>80%
StorageShort-term: +4°C; Long-term: -20°C to -80°C
Storage BufferPBS buffer

For gene information reference:

  • Gene ID: 67878

  • mRNA Refseq: NM_028975.3

  • Protein Refseq: NP_083251.2

  • UniProt ID: Q9CR67

What are effective strategies for genetic manipulation of TMEM33 in experimental models?

Several successful approaches have been documented:

Knockout Strategies:

  • Double crossover homologous recombination has been effective for targeted deletion of TMEM33, replacing the coding sequence with eGFP and hDHFR drug selection marker cassettes

  • TMEM33 knockout in P. berghei resulted in severe reduction in asexual blood stage growth and abolished pathogenicity

Tagging Methods:

  • C-terminal mNeonGreen tagging through double crossover homologous recombination successfully generated fluorescently labeled TMEM33 without affecting function

  • Both N-terminal (HA-TMEM33) and C-terminal (TMEM33-HA) tagging approaches have been validated for immunoprecipitation studies

Expression Systems:

  • Conditional expression systems using doxycycline-inducible promoters allow controlled TMEM33 expression at physiological levels (TMEM33/TOP1 ratio of approximately 0.2)

What methods are most reliable for studying TMEM33 protein interactions?

Multiple complementary approaches have proven effective:

Co-immunoprecipitation:

  • Successfully demonstrated interactions between TMEM33 and PC2

  • Identified complex formation between TMEM33, RNF5, and SCAP

  • Both overexpressed tagged versions and endogenous proteins can be co-immunoprecipitated

Yeast-2-hybrid:

  • LexA/B42 based Grow'n'Glow system confirmed interactions between:

    • C-terminus of TMEM33 and N-terminus of PC2

    • N-terminus of TMEM33 and C-terminus of PC2

Proximity Ligation Assay:

  • Successfully detected direct interaction between TMEM33 and RNF5 in MDA-MB-231 cells

Mass Spectrometry:

  • Identified 73 peptides of PC2 co-purified with TMEM33 (versus 0 in control conditions)

  • Revealed proteome-wide changes induced by TMEM33 overexpression

How does TMEM33 contribute to cancer progression and what is its prognostic value?

TMEM33 shows strong associations with cancer progression and patient outcomes:

Expression Pattern:

  • Significantly upregulated in 24 of 33 cancer types compared to normal tissues

  • Higher expression in adenosquamous compared with squamous cell carcinoma of cervical cancer

Prognostic Value:

Multivariate Analysis:

VariableHazard Ratio (95% CI)p Value
TMEM33 (High vs Low)3.739 (1.189-11.758)0.024*
T4 stage84.580 (7.056-1013.898)<0.001***
N1 stage2.760 (1.023-7.442)0.045*

*p<0.05, **p<0.01, ***p<0.001

Functional Studies:

  • Knockdown of TMEM33 in cervical cancer cells significantly decreased proliferation in both HeLa and SiHa cells

  • TMEM33 expression correlates with tumorigenesis-related genes RNF4, OCIAD1, TMED5, DHX15, MED28, and LETM1

What is the role of TMEM33 in ER stress response and unfolded protein response (UPR) pathways?

TMEM33 is a novel regulator of ER stress and UPR signaling:

UPR Pathway Regulation:

  • TMEM33 is a stress-inducible ER transmembrane protein

  • It acts as a new binding partner of PERK, a key UPR sensor

  • Overexpression of TMEM33 leads to increased phosphorylation of:

    • eIF2α (PERK pathway)

    • IRE1α (IRE1 pathway)

Downstream Effects:

  • TMEM33 overexpression increases expression of:

    • ATF4-CHOP (downstream of PERK)

    • XBP1-S (downstream of IRE1α)

    • Apoptotic signals including cleaved caspase-7 and cleaved PARP

    • Autophagosome protein LC3II

Autophagy Modulation:

  • TMEM33 stimulates autophagic flux under basal conditions

  • During tunicamycin-mediated ER stress, TMEM33 attenuates autolysosome degradation

  • TMEM33 reduces expression of the autophagy marker p62

How does the TMEM33-RNF5-SCAP axis regulate lipid homeostasis in cancer cells?

TMEM33 plays a crucial role in regulating lipid metabolism through a novel mechanism:

Complex Formation:

  • TMEM33 forms a triple complex with:

    • RNF5 (an E3 ubiquitin ligase involved in ER-associated degradation)

    • SCAP (SREBP cleavage-activating protein)

Mechanism of Action:

  • Overexpression of TMEM33 triggers polyubiquitination of SCAP

  • This leads to decreased SCAP protein levels

  • TMEM33 recruits RNF5 to promote SCAP degradation

  • Knockdown of RNF5, abrogates TMEM33-induced SCAP polyubiquitination

Interaction Domains:

  • The sterol-sensing domain (aa 280-445) of SCAP is the main region that interacts with TMEM33

  • TMEM33 expression inversely correlates with SCAP protein levels, but positively correlates with RNF5 levels

Downstream Effects:

  • TMEM33 overexpression decreases proteins related to cholesterol and fatty acid synthesis

  • This effect on lipid metabolism may contribute to cancer cell growth regulation

How does TMEM33 regulate intracellular calcium homeostasis in renal tubular epithelial cells?

TMEM33 plays a sophisticated role in calcium regulation:

Interaction with PC2:

  • TMEM33 forms a complex with Polycystin-2 (PC2), a calcium-permeable non-selective cation channel

  • This interaction occurs at the ER membrane but is absent at the primary cilium

Calcium Signaling Modulation:

  • TMEM33 reduces intracellular calcium content in a PC2-dependent manner

  • It impairs lysosomal calcium refilling

  • This alteration leads to translocation of cathepsins and NAG from lysosomes to the cytosol

Functional Consequences:

  • The decrease in IP3 signaling mediated by TMEM33 impacts:

    • Lysosomal size and function

    • Autophagy processes

    • Cell death pathways

What is the significance of TMEM33 in parasitic infection models?

TMEM33 plays critical roles in parasite development:

Localization and Expression:

  • In Plasmodium berghei, TMEM33 localizes to the ER throughout blood and mosquito stages of development

Knockout Effects:

  • Targeted deletion of TMEM33 demonstrates its importance for:

    • Asexual blood stages development

    • Ookinete development

    • Sporozoite infectivity in the mammalian host

Molecular Mechanism:

  • Loss of TMEM33 results in:

    • Initiation of ER stress response

    • Induction of autophagy

Development Impact:

  • Deletion of TMEM33 caused severe reduction in:

    • Asexual blood stage growth

    • Abolished pathogenicity

    • Oocyst development

    • Oocyst sporozoite development

    • Salivary gland sporozoite development

What experimental approaches can resolve contradictory findings regarding TMEM33 function in different cellular systems?

Researchers encountering conflicting data should consider:

Context-Dependent Functions:

  • TMEM33 exhibits tissue-specific and condition-specific effects:

    • Promotes autophagy under basal conditions but attenuates it under ER stress

    • Shows varied expression and function across cancer types

Methodological Considerations:

  • Expression Level Control:

    • Use conditional expression systems to achieve physiological levels (TMEM33/TOP1 ratio of ~0.2)

    • Compare both knockdown and overexpression models in the same study

  • Interaction Partner Analysis:

    • Assess expression levels of key partners (PC2, RNF5, SCAP) that may influence TMEM33 function

    • Use proximity ligation assays to validate direct interactions in specific cell types

  • Pathway Assessment:

    • Simultaneously evaluate multiple pathways affected by TMEM33:

      • ER stress markers (p-eIF2α, p-IRE1α, ATF4, XBP1-S)

      • Autophagy markers (LC3II, p62)

      • Lipid metabolism indicators (SREBP activation, SCAP levels)

      • Calcium homeostasis (IP3 signaling, lysosomal calcium)

  • Timing Considerations:

    • Assess immediate versus long-term effects of TMEM33 manipulation

    • Evaluate effects under both basal and stress-induced conditions

What are promising therapeutic strategies targeting TMEM33 in disease models?

Based on current understanding, several therapeutic approaches warrant investigation:

Cancer Therapeutics:

  • TMEM33 inhibitors could potentially slow cancer progression given:

    • Its overexpression in multiple cancer types

    • Correlation with poor prognosis

    • Role in promoting cell proliferation

  • ROC curve analysis (AUC: 0.881) supports development of TMEM33 as a diagnostic biomarker for cervical cancer

Anti-parasitic Strategies:

  • TMEM33 represents a potential drug target for malaria treatment:

    • Essential for all life cycle stages of Plasmodium

    • Critical for parasite development and infectivity

Lipid Metabolism Disorders:

  • Modulating the TMEM33-RNF5-SCAP axis could provide therapeutic benefits for:

    • Cancer types dependent on lipid synthesis

    • Metabolic disorders involving dysregulated cholesterol or fatty acid metabolism

ER Stress-Related Conditions:

  • Targeting TMEM33's role in ER stress response could benefit conditions where UPR dysregulation contributes to pathology

What technological advancements would facilitate better understanding of TMEM33 function?

Several methodological approaches could advance TMEM33 research:

Structural Biology:

  • Cryogenic electron microscopy of TMEM33 complexes with interaction partners

  • Structure-based drug design targeting specific TMEM33 domains

Real-Time Imaging:

  • Live-cell calcium imaging to monitor TMEM33 effects on calcium dynamics

  • FRET-based sensors to detect TMEM33 conformational changes or interactions

Multi-omics Integration:

  • Combined proteomics, lipidomics, and transcriptomics to comprehensively map TMEM33-dependent pathways

  • Single-cell analyses to resolve heterogeneous responses in complex tissues

In Vivo Models:

  • Tissue-specific and inducible TMEM33 knockout mouse models

  • Humanized mouse models expressing patient-derived TMEM33 variants

Chemical Biology:

  • Development of small molecule modulators of TMEM33 function

  • Photocrosslinking approaches to map transient interaction surfaces

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.