Recombinant Mouse Transmembrane protein 41A (Tmem41a)

Shipped with Ice Packs
In Stock

Description

Production and Purification

The protein is expressed in E. coli and purified via affinity chromatography leveraging the His-tag . Critical handling guidelines include:

  • Storage: Lyophilized powder stable at -20°C/-80°C; reconstituted aliquots stored at 4°C for ≤1 week .

  • Reconstitution: Tris/PBS-based buffer (pH 8.0) with 6% trehalose; glycerol (5–50%) recommended for long-term storage .

  • Stability: Avoid repeated freeze-thaw cycles to prevent degradation .

Detection and Quantification

Quantitative detection in biological samples (e.g., tissue homogenates, cell lysates) is achieved using ELISA kits. Representative specifications include:

ParameterDetail
Detection Range0.156–10 ng/ml
Sample TypesTissue homogenates, cell lysates, biological fluids
Detection MethodColorimetric
ReactivityMouse-specific
Sensitivity≤0.078 ng/ml

These kits enable precise measurement of Tmem41a levels in experimental models, supporting studies on its expression dynamics .

Cancer Biology

While Tmem41a’s endogenous role includes involvement in lipid metabolism and autophagy, recombinant forms are pivotal in studying its overexpression in pathologies. For example, TMEM41A overexpression correlates with poor prognosis in endometrial carcinoma (EC), where it influences stromal/immune scores and RNA modifications . Recombinant Tmem41a facilitates mechanistic studies to dissect these pathways.

Immune Microenvironment Studies

Recombinant Tmem41a is used to investigate immune cell interactions, including correlations with macrophages, CD8+ T cells, and dendritic cells in EC models .

Key Considerations for Use

  • Specificity: Antibody validation is essential due to potential cross-reactivity with homologous proteins .

  • Functional Assays: Pair recombinant Tmem41a with knockdown models (e.g., CRISPR/Cas9) to validate phenotypic effects .

  • Ethical Compliance: Strictly adhere to institutional guidelines for animal-derived reagents .

Future Directions

Current research gaps include elucidating Tmem41a’s post-translational modifications and isoform-specific interactions. Advances in cryo-EM and in vivo imaging using recombinant protein variants may address these questions .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format we have in stock. However, if you have any specific requirements for the format, please indicate them when placing your order, and we will prepare it accordingly.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery time information.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please communicate with us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by several factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
If you have a specific tag type in mind, please inform us, and we will prioritize developing the specified tag.
Synonyms
Tmem41a; Transmembrane protein 41A
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
18-264
Protein Length
Full Length of Mature Protein
Species
Mus musculus (Mouse)
Target Names
Tmem41a
Target Protein Sequence
LYLLSTRLPLGPRLAAAGEPEGRSLWFPSDLAELRELSEVLREYRKEHQAYVFLLFCSAY LYKQGFAIPGSSFLNVLAGALFGPWLGLLLCCVLTSVGATGCYLLSSLFGKQLVISYFPD KVALLQKKVEENRNSLFFFLLFLRLFPMTPNWFLNLSAPILNIPIVQFFFSVLIGLIPYN FICVQTGSILSTLTSLDALFSWETVLKLLAIALVALVPGTLIKKFSQKRLALSETSDIGH PDRRKDA
Uniprot No.

Target Background

Gene References Into Functions
  1. This study demonstrated a reduction in TMEM41A expression levels in a pair of GC cell lines, revealing that high TMEM41A expression levels may promote GC-associated metastasis, potentially mediated by the downregulation of E-cadherin expression. PMID: 30015937
Database Links
Protein Families
TMEM41 family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is Transmembrane Protein 41A (Tmem41a)?

Transmembrane Protein 41A (Tmem41a) is a membrane-spanning protein that has gained attention for its potential roles in cellular processes and disease progression. While the specific molecular function of Tmem41a has not been fully characterized, research indicates it is expressed in various tissues in mice. The protein belongs to the broader family of transmembrane proteins that typically contain multiple membrane-spanning domains and play crucial roles in cellular signaling, transport, and structural organization. Based on available research, Tmem41a has been particularly studied in the context of cancer biology, where its expression levels appear to correlate with disease progression and patient outcomes . The gene encoding Tmem41a in rats has been cataloged with the accession number NM_001100805.1, and researchers have developed various tools to study its function, including siRNA vectors for gene knockdown experiments .

How does mouse Tmem41a differ from human TMEM41A?

Understanding the similarities and differences between mouse Tmem41a and human TMEM41A is crucial for translational research. While the search results don't provide direct comparison between the mouse and human versions, we can infer some information from related research. Expression patterns of TMEM41A appear to be conserved across species to some extent, with notable expression in cancer tissues observed in human studies . The human TMEM41A has been studied in endometrial carcinoma, where its overexpression correlates with poor prognosis, suggesting a potential role in cancer progression . Researchers investigating Tmem41a should carefully consider these interspecies differences when designing experiments and interpreting results from mouse models intended to understand human disease. Protein sequence alignment and functional domain analysis between mouse and human versions would be recommended for researchers planning cross-species studies or attempting to translate findings from mouse models to human applications.

What are the common methods to study Tmem41a expression?

Several methodological approaches are available for studying Tmem41a expression at both the mRNA and protein levels. For mRNA expression analysis, quantitative PCR (qPCR) represents a standard approach, with researchers needing to design specific primers targeting the Tmem41a transcript. In the research described in the search results, transcriptome data analysis was employed to examine TMEM41A expression in endometrial carcinoma, utilizing data from the TCGA database in FPKM (Fragments Per Kilobase Million) format . For protein-level detection, western blotting using specific antibodies against Tmem41a would be the conventional approach, though the search results don't directly mention antibody availability. Additionally, immunohistochemistry can be employed to visualize Tmem41a expression in tissue sections, which would be particularly valuable for cancer studies examining its expression in tumor versus normal tissues. For functional studies, siRNA-mediated knockdown using vectors like the AAV siRNA Pooled Vector mentioned in the search results allows researchers to assess the effects of Tmem41a reduction on cellular phenotypes .

What vectors and constructs are available for Tmem41a studies?

Several research tools have been developed to facilitate Tmem41a studies, with viral vectors being particularly valuable for gene modulation experiments. The search results specifically mention the availability of Tmem41a AAV siRNA Pooled Vector for rats (catalog number 47049166), which employs a dual convergent promoter system where the sense and antisense strands of the siRNA are expressed by two different promoters rather than in a hairpin loop . This design helps avoid potential recombination events that can occur with traditional shRNA approaches. The vector includes a GFP reporter gene, allowing for visual confirmation of transduction efficiency, and operates within the pAAV-siRNA-GFP-hGH-amp system with a vector size of 6013 base pairs . For researchers requiring transient transfection rather than viral transduction, these vectors can also be directly transfected into target cells using reagents like Lipofectamine or Fugene, providing flexibility in experimental approaches . When selecting vectors for Tmem41a studies, researchers should consider whether they require stable or transient expression changes, the cell types being studied, and the specific research questions being addressed.

How can Tmem41a be effectively knocked down in mouse models?

Effective knockdown of Tmem41a in mouse models requires careful consideration of delivery methods, vector design, and validation strategies. Based on the available search results, AAV (Adeno-Associated Virus) vectors carrying siRNA constructs represent a promising approach for Tmem41a knockdown . When using such vectors, researchers should consider utilizing a pooled siRNA approach, which includes multiple siRNA sequences targeting different regions of the Tmem41a transcript to increase knockdown efficiency. For in vivo applications, the route of administration should be selected based on the target tissues of interest, with options including intravenous, intramuscular, or stereotactic injection for brain-specific delivery. The search results indicate that effective knockdown usually requires a multiplicity of infection (MOI) >5,000, and assessment should be performed 5-7 days post-infection to allow sufficient time for the siRNA machinery to reduce target gene expression . For validation of knockdown efficiency, quantitative PCR is recommended to measure the reduction in Tmem41a mRNA levels compared to control conditions, with successful knockdown typically defined as achieving at least 70% reduction in gene expression .

What are best practices for validating Tmem41a expression changes?

Validating Tmem41a expression changes, whether from knockdown or overexpression experiments, requires rigorous methodological approaches to ensure reliable results. For knockdown validation, quantitative PCR (qPCR) represents the gold standard for measuring reductions in mRNA expression, with appropriate housekeeping genes selected as internal controls to normalize expression data . Researchers should design primers specific to Tmem41a that span exon-exon junctions to avoid amplification of genomic DNA. At the protein level, western blotting with specific antibodies against Tmem41a provides confirmation that the observed mRNA changes translate to reduced protein expression. When using viral vectors with reporter genes like GFP, researchers should first confirm high transduction efficiency (>80%) before assessing knockdown effects . For overexpression studies, similar validation approaches apply, with the addition of checking for proper localization of the expressed protein through techniques like immunofluorescence microscopy, particularly important for transmembrane proteins that may require correct trafficking to the plasma membrane. In clinical samples, techniques like receiver operating characteristic (ROC) analysis can be employed to determine the diagnostic value of Tmem41a expression levels, as demonstrated in endometrial cancer research .

What is the role of Tmem41a in cancer progression?

The role of Tmem41a in cancer progression has emerged as a significant area of research, with compelling evidence from endometrial carcinoma studies. According to the search results, TMEM41A was found to be overexpressed in endometrial carcinoma (EC) tissues compared to normal tissues, suggesting a potential role in oncogenesis or tumor progression . This overexpression was not merely correlative but demonstrated prognostic value, as high TMEM41A expression correlated with poor survival outcomes in EC patients . Specifically, TMEM41A overexpression was associated with several clinical parameters, including advanced clinical stage, patient age, weight, histological subtype, tumor grade, and survival status, indicating its potential utility as a biomarker for disease progression and patient stratification . Multivariate Cox regression analysis identified TMEM41A overexpression as an independent factor for poor prognosis in EC patients, alongside clinical stage, age, tumor grade, and radiotherapy status . The development of nomograms revealed a correlation between TMEM41A expression levels and patient survival at 1, 3, and 5 years, further strengthening its potential clinical relevance . These findings collectively suggest that Tmem41a may be functionally involved in cancer progression pathways, though the specific molecular mechanisms remain to be fully elucidated.

How does Tmem41a interact with the immune microenvironment?

The interaction between Tmem41a and the immune microenvironment represents a fascinating aspect of its biology with potential implications for immunotherapy approaches. Research in endometrial carcinoma has revealed that TMEM41A overexpression significantly correlates with multiple immune parameters, including stromal score, immune score, and estimate score, suggesting broad influence over the tumor immune landscape . More specifically, TMEM41A expression levels showed significant associations with numerous immune cell populations, including NK CD56 bright cells, immature dendritic cells (iDC), NK cells, eosinophils, plasmacytoid dendritic cells (pDC), T cells, regulatory T cells (Treg), cytotoxic cells, mast cells, Th17 cells, neutrophils, activated dendritic cells (aDC), NK CD56 dim cells, T follicular helper cells (TFH), Th2 cells, CD8 T cells, and macrophages . This extensive correlation with both innate and adaptive immune components suggests that Tmem41a may play a role in modulating anti-tumor immunity, potentially through direct or indirect mechanisms affecting immune cell recruitment, activation, or function. Additionally, TMEM41A expression was associated with various immune cell markers, though the specific markers were not detailed in the search results . These findings highlight the potential importance of considering Tmem41a in the context of cancer immunology and suggest that its modulation might influence responses to immunotherapeutic interventions.

What RNA modifications are associated with Tmem41a expression?

RNA modifications represent an emerging area of interest in relation to Tmem41a biology and function. According to the search results, TMEM41A overexpression in endometrial carcinoma was significantly correlated with RNA modifications, though the specific types of modifications were not detailed . RNA modifications, including methylation (such as m6A, m5C, and m1A), pseudouridylation, and adenosine-to-inosine editing, can significantly impact RNA stability, localization, translation efficiency, and interaction with RNA-binding proteins. The association between Tmem41a expression and RNA modifications suggests several possible relationships: Tmem41a might regulate enzymes involved in RNA modification pathways, Tmem41a expression itself might be regulated through RNA modifications of its transcript, or both phenomena might be coordinately regulated by upstream factors. For researchers investigating Tmem41a, this connection opens up important avenues for exploration, including the identification of specific RNA modifications affected by Tmem41a expression changes, the molecular mechanisms connecting Tmem41a to RNA modification machinery, and the functional consequences of these modifications for cancer-related gene expression programs. Methodological approaches to investigate these relationships might include transcriptome-wide mapping of RNA modifications in the context of Tmem41a modulation, direct assessment of RNA modification enzyme activities, and functional studies examining the consequences of preventing specific RNA modifications.

How to address inconsistent Tmem41a knockdown efficiency?

Inconsistent knockdown efficiency represents a common challenge in Tmem41a research that requires systematic troubleshooting approaches. Based on the available search results, several strategies can be implemented to improve knockdown consistency. First, researchers should consider using pooled siRNA approaches, as mentioned in the available Tmem41a AAV siRNA Pooled Vector, which contains multiple siRNA sequences targeting different regions of the transcript . This pooled approach increases the likelihood of achieving effective knockdown by overcoming potential sequence-specific barriers such as secondary structures in the target RNA. Second, optimization of viral transduction conditions is crucial, with recommendations to use a multiplicity of infection (MOI) >5,000 and to assess knockdown effects 5-7 days post-infection to allow sufficient time for the siRNA machinery to reduce target gene expression . For cell lines resistant to standard transduction protocols, optimization of transduction enhancers, cell density, and timing can significantly improve results. Third, if initial knockdown attempts prove ineffective, researchers should consider alternative siRNA sequences, as noted in the guarantee for the AAV vectors where replacement with alternative siRNA sequences is offered if the initial set fails to achieve >70% knockdown efficiency . Finally, for genes particularly resistant to knockdown, combination approaches using both transcriptional (CRISPR interference) and post-transcriptional (siRNA) methods might be necessary to achieve sufficient reduction in gene expression.

What controls should be used in Tmem41a overexpression studies?

Designing appropriate controls for Tmem41a overexpression studies is essential for generating reliable and interpretable results. For plasmid-based overexpression, researchers should include an empty vector control that contains the same promoter and regulatory elements as the Tmem41a expression construct but lacks the Tmem41a coding sequence. This control accounts for potential effects of the vector backbone and the process of transfection or transduction itself. Additionally, a scrambled control that expresses a protein of similar size and characteristics but with a different sequence can help distinguish between specific effects of Tmem41a overexpression versus general effects of protein overproduction. According to the search results, when studying the effects of siRNA-mediated knockdown, a scramble negative control is recommended (referenced as Cat.# LV015-G), which could be adapted as a principle for overexpression studies as well . For functional studies, rescue experiments involving the reintroduction of Tmem41a in knockdown models provide compelling evidence for specificity. When conducting overexpression studies in the context of cancer research, as suggested by the TMEM41A studies in endometrial carcinoma, it is advisable to include both normal cell lines and cancer cell lines with varying baseline expression levels of Tmem41a to understand the context-dependent effects of overexpression .

How to optimize recombinant Tmem41a protein production?

Optimizing the production of recombinant Tmem41a protein presents specific challenges due to its transmembrane nature, requiring careful consideration of expression systems and purification strategies. While the search results don't directly address Tmem41a protein production, we can draw insights from related transmembrane protein production approaches. Expression of transmembrane proteins often benefits from specialized host systems such as insect cells (via baculovirus expression) or mammalian cells that provide appropriate membrane environments and post-translational modifications. For initial construct design, including purification tags at either the N-terminus or C-terminus, avoiding the transmembrane domains, can facilitate downstream purification. Some researchers opt to express only the extracellular or intracellular domains of transmembrane proteins to improve solubility and yield. Based on approaches used for other transmembrane proteins, detergent screening is a critical step, as the choice of detergent significantly impacts protein stability and functionality during solubilization and purification. Common detergents include n-dodecyl-β-D-maltoside (DDM), digitonin, and CHAPS, with the optimal choice depending on the specific characteristics of Tmem41a. For quality control, size-exclusion chromatography can verify protein monodispersity, while circular dichroism or thermal shift assays can confirm proper folding. Functional assays specific to the known or hypothesized activities of Tmem41a should be developed to ensure that the recombinant protein retains its native activities.

What are emerging applications of Tmem41a as a biomarker?

The potential of Tmem41a as a biomarker represents an exciting frontier in translational research, particularly in oncology. Based on the search results, TMEM41A overexpression has demonstrated significant value as a diagnostic and prognostic biomarker in endometrial carcinoma (EC) . Specifically, receiver operating characteristic (ROC) analysis revealed that TMEM41A expression could effectively distinguish between normal and EC tissues, suggesting its utility as a diagnostic biomarker . More importantly, survival analysis indicated that patients with high TMEM41A expression had significantly worse prognosis than those with low expression, establishing its potential as a prognostic biomarker . The development of nomograms incorporating TMEM41A expression levels alongside clinical parameters enabled the prediction of patient survival at 1, 3, and 5 years, demonstrating the practical clinical application of this biomarker . Future research directions might explore whether Tmem41a expression in liquid biopsies (circulating tumor cells or cell-free DNA) correlates with tissue expression, potentially enabling non-invasive monitoring of disease progression. Additionally, investigating whether Tmem41a expression predicts response to specific therapeutic interventions, particularly immunotherapies given its correlation with immune parameters, could significantly enhance its clinical utility . The consistent finding that TMEM41A overexpression correlates with poor prognosis suggests it might also serve as a biomarker for identifying high-risk patients who might benefit from more aggressive treatment approaches.

How might Tmem41a be targeted therapeutically?

Therapeutic targeting of Tmem41a represents a potentially promising approach based on its apparent role in cancer progression, though specific targeting strategies remain to be developed. Given the association between TMEM41A overexpression and poor prognosis in endometrial carcinoma, reducing its expression or activity could potentially yield therapeutic benefits . Several approaches could be considered for therapeutic targeting. First, RNAi-based therapeutics, similar to the siRNA approaches used in research settings, could be developed to reduce Tmem41a expression in tumors . The availability of effective siRNA sequences that achieve >70% knockdown efficiency in research settings provides a starting point for such therapeutic development . Second, if Tmem41a functions through protein-protein interactions, small molecule inhibitors could potentially be developed to disrupt these interactions, though this would require detailed structural understanding of Tmem41a and its binding partners. Third, given the significant correlation between TMEM41A expression and various immune cell populations, including NK cells, T cells, and macrophages, combinatorial approaches targeting Tmem41a alongside immunotherapeutic interventions might prove particularly effective . For instance, Tmem41a inhibition might enhance the efficacy of immune checkpoint inhibitors by favorably modulating the tumor immune microenvironment. Finally, if Tmem41a is found to be enzymatically active, specific inhibitors of its catalytic activity could be developed, similar to approaches used for receptor tyrosine kinases and other enzymatically active membrane proteins.

What are unresolved questions about Tmem41a function?

Despite growing interest in Tmem41a, numerous fundamental questions about its molecular and cellular functions remain unresolved. First, the basic biochemical function of Tmem41a remains largely unknown—whether it functions as a channel, transporter, enzyme, scaffold protein, or through another mechanism has not been definitively established. Second, while TMEM41A overexpression correlates with poor prognosis in endometrial carcinoma, the causal relationship and underlying mechanisms by which Tmem41a might promote cancer progression remain to be elucidated . Third, the extensive correlation between TMEM41A expression and various immune cell populations raises questions about the directionality of this relationship—does Tmem41a directly influence immune cell recruitment or function, or do certain immune environments induce Tmem41a expression ? Fourth, the association between TMEM41A and RNA modifications suggests a potential role in regulating gene expression post-transcriptionally, but the specific modifications affected and the molecular mechanisms involved require further investigation . Fifth, the subcellular localization and trafficking of Tmem41a remains poorly characterized, which is crucial for understanding its function as a transmembrane protein. Methodological approaches to address these questions might include proteomic analyses to identify Tmem41a binding partners, CRISPR-based genetic screens to identify synthetic lethal interactions, detailed structure-function studies, and in vivo models with tissue-specific manipulation of Tmem41a expression. Resolving these fundamental questions will be essential for fully understanding the biology of Tmem41a and realizing its potential as a therapeutic target.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.