Recombinant Mouse Transmembrane protein 41B (Tmem41b)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Please note: We will prioritize shipping the format we currently have in stock. However, if you have a specific format requirement, please include it in your order notes. We will prepare the product according to your request.
Lead Time
Delivery times may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timelines.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please notify us in advance, as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure all contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers may use this as a reference.
Shelf Life
The shelf life of our products is influenced by various factors, including storage conditions, buffer composition, storage temperature, and the intrinsic stability of the protein.
Generally, the shelf life for liquid forms is 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type preference, please inform us, and we will prioritize developing the specified tag.
Synonyms
Tmem41b; D7Ertd743e; Kiaa0033; Transmembrane protein 41B; Protein stasimon
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-291
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Tmem41b
Target Protein Sequence
MAKGRVADRSPTEMLHSTPAGDRAVRTQGSAAPGSKDHLNEKPCAEAGSARTSLLILVSI FSCAAFVMFLVYKNFPQLSEEERVNMKVPRDMDDAKALGKVLSKYKDTFYVQVLVAYFAT YIFLQTFAIPGSIFLSILSGFLYPFPLALFLVCLCSGLGASFCYMLSYLVGRPVVYKYLT EKAVKWSQQVERHREHLINYIIFLRITPFLPNWFINITSPVINVPLKVFFIGTFLGVAPP SFVAIKAGTTLHQLTTAGEAVSWSSVFILMVLALLSILPAIFQKQLKQKFE
Uniprot No.

Target Background

Function
Transmembrane protein 41B (Tmem41b) is a phospholipid scramblase involved in lipid homeostasis and membrane dynamics. It exhibits phospholipid scramblase activity towards cholesterol and phosphatidylserine, as well as phosphatidylethanolamine and phosphatidylcholine. Tmem41b plays a crucial role in autophagosome formation, specifically participating in the early stages of autophagosome biogenesis at the endoplasmic reticulum (ER) membrane. It re-equilibrates the leaflets of the ER as lipids are extracted by ATG2 (ATG2A or ATG2B) to facilitate autophagosome assembly. Beyond autophagy, Tmem41b is involved in other processes requiring phospholipid scramblase activity. It is essential for normal motor neuron development.
Gene References Into Functions
  1. Defective U12 splicing and reduced mRNA levels of Stasimon (NP_705745) were observed in the motor circuit neurons of mice with spinal muscular atrophy. PMID: 23063131
Database Links
Protein Families
TMEM41 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein. Endomembrane system.
Tissue Specificity
Expressed in brain, spinal cord, kidney and first lumbar dorsal root ganglia during postnatal development. Expressed in motor neurons and proprioceptive neurons.

Q&A

What is the cellular localization of Tmem41b?

Tmem41b is primarily localized to the endoplasmic reticulum (ER). Immunostaining studies using both N- and C-terminally tagged Tmem41b have demonstrated a tubular pattern that co-localizes with the ER marker calnexin and KDEL . This localization has been confirmed through CRISPR-mediated endogenous tagging approaches, validating that the native protein robustly co-localizes with ER markers . Moreover, Tmem41b contains a di-lysin-based ER retention motif (K(X)KXX) at its C-terminus, which contributes to its retention in the ER . Interaction proteomics has also identified several COPI components (COPA, COPB1, COPG2, COPE, COPZ1) as Tmem41b-interacting proteins, consistent with its ER localization .

What is the structural characterization of Tmem41b?

Tmem41b is a multipass transmembrane protein with six predicted transmembrane domains . It contains a "SNARE-associated Golgi protein" domain that shares homology with bacterial DedA proteins, yeast TVP38, and mammalian proteins including TMEM41A, TMEM64, and VMP1 . These proteins share a conserved region called the VTT domain (based on homology among VMP1, TMEM41A/B, and TMEM64) . Recent findings have identified Tmem41b as a phospholipid scramblase, which helps explain its role in membrane remodeling activities and lipid distribution across membrane leaflets . This structural arrangement is critical for its functions in lipid mobilization and organizing membrane curvature required for various cellular processes.

What are the primary biological functions of Tmem41b?

Tmem41b serves multiple critical cellular functions:

  • It functions as a phospholipid scramblase that regulates the distribution of phospholipids and cholesterol across membrane leaflets

  • It plays an essential role in autophagy initiation and progression

  • It participates in lipid droplet formation and lipid mobilization

  • It facilitates viral infection for multiple virus families, particularly flaviviruses and coronaviruses, by supporting membrane remodeling required for viral replication complexes

  • It influences mitochondrial function, particularly β-oxidation of fatty acids

Studies have shown that Tmem41b-deficient cells display impaired autophagosome formation, enlarged lipid droplets, and resistance to certain viral infections, highlighting its multifaceted roles in cellular physiology .

How is Tmem41b expression regulated?

Tmem41b has been identified as an interferon-stimulated gene (ISG), as its expression can be induced by interferon (IFN) . This regulation connects Tmem41b to the innate immune response system, which is particularly relevant given its role in viral infections. Research has demonstrated that Tmem41b expression levels vary across different cell types, which partly explains the differential requirement for Tmem41b in viral infection processes among various cell lines . For instance, while Tmem41b is critical for yellow fever virus (YFV) infection in HAP1, JEG3, and A549 cells, it is not required in Huh-7.5 cells . This variable expression pattern may be influenced by tissue-specific transcription factors and regulatory elements that remain to be fully characterized.

Experimental Design Questions

To assess Tmem41b's role in autophagy, employ the following methodological approaches:

  • Fluorescence microscopy: Monitor LC3 puncta formation and co-localization with p62/SQSTM1 in Tmem41b knockout versus wild-type cells under basal and starvation conditions . Co-staining of LAMP1 with p62 can reveal defects in lysosomal delivery of autophagy cargo receptors .

  • Immunoblotting: Analyze LC3-I to LC3-II conversion and p62/SQSTM1 degradation with and without lysosomal inhibitors (like Bafilomycin A1) to assess autophagy flux .

  • Transmission electron microscopy: Examine the ultrastructure of autophagosomes to detect morphological abnormalities in Tmem41b-deficient cells .

  • Bacterial clearance assays: Assess the ability of cells to clear intracellular bacteria through autophagy (xenophagy) as a functional readout . Tmem41b-deficient cells show compromised lysosomal delivery of autophagy cargo receptors and their cargo, such as intracellular bacteria .

  • Comparative analysis: Compare Tmem41b knockout phenotypes with those of canonical autophagy gene knockouts (e.g., ATG7) to distinguish Tmem41b-specific effects from general autophagy defects .

What methods are appropriate for studying Tmem41b's role in lipid metabolism?

To investigate Tmem41b's function in lipid metabolism, implement these experimental approaches:

  • Lipid droplet analysis: Use fluorescent lipid dyes (BODIPY 493/503) to visualize and quantify lipid droplet size and number in Tmem41b knockout versus control cells . Tmem41b-deficient cells typically display enlarged lipid droplets .

  • Mitochondrial function assays: Measure basal and maximal oxygen consumption rates using a Seahorse XF analyzer to assess mitochondrial respiration and fatty acid oxidation . Specifically, use substrate-limited medium and measure oxygen consumption with or without etomoxir (an inhibitor of mitochondrial FA import) to evaluate endogenous fatty acid utilization rates .

  • Lipidomics: Perform comprehensive lipidomic analysis to examine changes across major lipid classes following Tmem41b manipulation.

  • Fatty acid trafficking assays: Track fluorescently labeled fatty acids to monitor mobilization from lipid droplets to mitochondria in the presence or absence of Tmem41b.

  • Rescue experiments: Test whether lipid supplementation can rescue phenotypes in Tmem41b knockout cells, as demonstrated with pseudorabies virus (PRV) entry in TMEM41B knockdown cells .

ParameterWild-type CellsTmem41b KO CellsSignificance
Basal oxygen consumptionNormalDecreasedp < 0.05
Extracellular acidificationNormalIncreasedp < 0.05
Etomoxir-dependent oxygen consumptionNormalSignificantly lowerp < 0.05
Lipid droplet sizeNormalEnlargedp < 0.05

How can one generate and validate recombinant Tmem41b for functional studies?

For generating and validating recombinant Tmem41b:

  • Expression system selection: Use mammalian expression systems (HEK293 cells) for maintaining proper folding and post-translational modifications of this transmembrane protein.

  • Tag positioning: Consider epitope tag positioning carefully—C-terminal tags may interfere with the di-lysin-based ER retention motif (KQKFE) . Both N- and C-terminally tagged versions have been successfully used, but validation of proper localization is essential .

  • CRISPR knock-in approach: For studying endogenous protein, consider using CRISPR to tag the endogenous Tmem41b locus with a C-terminal epitope tag, which has been validated by immunoblot and genomic PCR .

  • Functional validation: Verify proper ER localization using co-localization with ER markers like calnexin . Test phospholipid scramblase activity and ability to rescue knockout phenotypes related to autophagy and lipid droplet formation .

  • Interaction proteomics: Validate protein-protein interactions, particularly with COPI components and other known Tmem41b-interacting proteins .

How does Tmem41b contribute to viral infection mechanisms?

Tmem41b facilitates viral infection through multiple mechanisms:

  • It is required for infection by all members of the Flaviviridae family tested, including Zika virus (ZIKV), Yellow Fever virus (YFV), Dengue virus (DENV), and West Nile virus (WNV) . It is also required for SARS-CoV-2 infection .

  • It supports membrane remodeling necessary for viral replication complex formation, creating a protected environment for viral genome replication . This function likely relates to its phospholipid scramblase activity, which affects membrane curvature .

  • For pseudorabies virus (PRV), Tmem41b influences viral entry by regulating lipid synthesis and the dynamics of clathrin-coated pits (CCPs) . Lipid replenishment can restore the CCP dynamics and PRV entry in Tmem41b knockdown cells .

  • Single nucleotide polymorphisms in TMEM41B present at nearly 20% frequency in East Asian populations can reduce flavivirus infection susceptibility .

  • The requirement for Tmem41b varies across cell types and virus strains. For example, while Tmem41b is critical for YFV infection in HAP1, JEG3, and A549 cells, it is not required in Huh-7.5 cells . Differences were even observed between the wild-type Asibi strain of YFV and the 17D vaccine strain that differ by only 31 amino acids .

What is the relationship between Tmem41b's autophagy function and its role in viral infection?

The relationship between Tmem41b's autophagy and viral infection roles is complex:

  • Both functions likely stem from Tmem41b's ability to modulate membrane curvature and lipid distribution as a phospholipid scramblase .

  • Autophagic machinery and membranes are often co-opted by viruses to support their replication. Tmem41b may serve as a critical link between autophagy-related membrane remodeling and viral replication complex formation .

  • Loss of Tmem41b reduces viral RNA replication and increases innate immune activation in response to flavivirus infection , suggesting its role in creating protected membrane environments for viral replication that shield viral components from immune detection.

  • Unlike canonical autophagy proteins, Tmem41b appears to function at an early stage of both autophagosome formation and viral replication complex assembly, potentially by facilitating appropriate membrane curvature .

  • The differential requirement for Tmem41b across cell types in viral infection parallels its variable importance in autophagy processes in different cellular contexts, suggesting shared regulatory mechanisms .

How do genetic variations in Tmem41b affect its function in disease contexts?

Genetic variations in Tmem41b have significant functional implications:

  • Single nucleotide polymorphisms present at nearly 20% frequency in East Asian populations can reduce flavivirus infection susceptibility . These genetic variations may represent naturally occurring resistance mechanisms against endemic flaviviruses.

  • The functional consequences of these polymorphisms likely involve altered protein conformation, stability, or interaction capabilities that impact Tmem41b's ability to support viral replication complex formation.

  • Understanding the structural and functional consequences of these polymorphisms could inform therapeutic strategies targeting Tmem41b for antiviral development.

  • Beyond viral infection, genetic variations in Tmem41b may impact autophagy efficiency and lipid metabolism, potentially influencing susceptibility to metabolic diseases, neurodegenerative disorders, and other conditions where these processes play important roles.

  • Comparative studies of Tmem41b variants across species and populations could reveal evolutionary adaptations related to pathogen exposure and metabolic requirements.

What is the interplay between Tmem41b and VMP1 in cellular processes?

The relationship between Tmem41b and VMP1 represents an important functional interaction:

  • Both proteins contain the conserved VTT domain and localize to the ER, where they function as phospholipid scramblases .

  • They share functional similarities in autophagy and lipid droplet regulation, but cannot completely compensate for each other—VMP1 knockout cells also display impaired autophagy and enlarged lipid droplets similar to Tmem41b-deficient cells .

  • Expression of TMEM41B-Myc significantly reduced lipid droplet size in TMEM41B knockout cells but was unable to rescue the phenotype in VMP1-deficient cells , indicating distinct roles despite their functional similarity.

  • Their relative expression levels across cell types may explain differential requirements in viral infection and cellular processes .

  • Both proteins influence autophagosome formation, lipid droplet size, and cellular lipid distribution, but may act at different stages or with different specificities .

  • Understanding their coordinated function is essential for comprehending membrane dynamics in autophagy, lipid metabolism, and viral replication .

How can conflicting data about Tmem41b's role in different cell types be reconciled?

Reconciling conflicting data about Tmem41b requires systematic consideration of several factors:

  • Expression level variations: Differential expression patterns of Tmem41b and VMP1 across cell types correlate with varying phenotypic outcomes . Western blot comparisons of HAP1, JEG3, A549, and Huh-7.5 cells have shown that these expression differences may explain why Tmem41b is critical for YFV infection in some cell lines but not others .

  • Virus strain specificity: Even within the same virus family, different strains may have varying dependencies on Tmem41b. For example, differences were observed between the wild-type Asibi strain of YFV and the 17D vaccine strain that differ by only 31 amino acids .

  • Experimental approaches: Standardizing knockout validation methods, phenotypic assay conditions, and quantification approaches across studies is essential for meaningful comparisons.

  • Compensatory mechanisms: Different cell types may possess varying capacities to compensate for Tmem41b deficiency through related proteins or alternative pathways.

  • Multi-omics integration: Combining proteomics, lipidomics, and transcriptomics data from different cell types can help identify context-dependent interaction networks that explain cell-type specific functions.

What challenges exist in measuring Tmem41b's phospholipid scramblase activity?

Measuring Tmem41b's scramblase activity presents several technical challenges:

  • Membrane protein purification: As a multipass transmembrane protein, Tmem41b requires careful detergent selection for purification while maintaining its native conformation and activity.

  • Lipid substrate specificity: Determining which specific phospholipids are most efficiently scrambled by Tmem41b requires comprehensive lipid profile analysis.

  • Assay systems: Developing reliable in vitro systems to measure scramblase activity that accurately represent the protein's behavior in cellular membranes.

  • Distinguishing from other membrane remodeling activities: Separating direct scramblase activity from other effects on membrane curvature, fluidity, or domain organization.

  • Redundancy with VMP1: The functional overlap with VMP1 complicates interpretation of results, requiring careful controls and comparative analyses.

How should researchers approach studying Tmem41b's role in clinical applications?

For translating Tmem41b research to clinical applications:

  • Antiviral development: Since Tmem41b is required for flavivirus and coronavirus infections, it represents a potential host-directed therapeutic target. Screening for small molecule inhibitors of Tmem41b's scramblase activity could yield broad-spectrum antivirals .

  • Genetic screening: Analyzing Tmem41b polymorphisms in patient populations could help identify individuals with altered susceptibility to viral infections .

  • Autophagy modulation: Given Tmem41b's role in autophagy, targeting its function could be relevant for diseases where autophagy dysregulation is implicated, including neurodegenerative disorders and cancer.

  • Lipid metabolism disorders: Tmem41b's impact on lipid droplet formation and fatty acid utilization suggests potential relevance to metabolic disorders .

  • Biomarker development: Changes in Tmem41b expression or activity could serve as biomarkers for disease states or treatment responses, particularly in infectious contexts or conditions with altered autophagy.

  • Animal models: Developing conditional knockout mouse models would be valuable for tissue-specific evaluation of Tmem41b functions in disease contexts.

What are emerging areas of Tmem41b research beyond viral infection and autophagy?

Emerging research areas for Tmem41b include:

  • Neurological functions: Given previous findings of Tmem41b's requirement for synaptic transmission in motor circuit neurons , further investigation of its neurological roles is warranted.

  • Immunomodulatory effects: As an interferon-stimulated gene , Tmem41b may have broader functions in innate immunity beyond viral infection.

  • Metabolic regulation: The connections between Tmem41b, lipid mobilization, and mitochondrial function suggest potential roles in metabolic homeostasis and energy production .

  • Developmental processes: The impact of Tmem41b on fundamental cellular processes suggests it may have important roles during development.

  • Cancer biology: Given its roles in autophagy and lipid metabolism, both of which are frequently dysregulated in cancer, Tmem41b's function in tumor cells deserves exploration.

What novel methodologies could advance Tmem41b research?

Advanced methodologies for Tmem41b research could include:

  • Cryo-electron microscopy: Determining the structure of Tmem41b at atomic resolution would provide insights into its mechanism of action as a scramblase.

  • Live-cell imaging of lipid dynamics: Using fluorescent lipid probes to visualize Tmem41b-mediated lipid redistribution in real-time.

  • Organoid models: Studying Tmem41b function in more physiologically relevant 3D tissue models.

  • Single-cell analysis: Examining cell-to-cell variation in Tmem41b expression and its correlation with cellular phenotypes.

  • CRISPR-based screening: Identifying synthetic lethal interactions and genetic modifiers of Tmem41b function.

  • Pharmacological modulators: Developing specific inhibitors or activators of Tmem41b to probe its function and potential therapeutic applications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.