Recombinant Mouse Transmembrane protein 42 (Tmem42)

Shipped with Ice Packs
In Stock
Cat. No.
BT2148086
Source
in vitro E.coli expression system
Synonyms
Tmem42; Transmembrane protein 42
Quick Inquiry

Description

Molecular Characterization of Tmem42

Gene Details:

  • Gene Symbol: Tmem42 (Mouse)

  • NCBI Gene ID: 66079

  • Accession Number: NM_025339.4 (transcript variant 1)

  • Protein Uniprot ID: Q8WUQ6 (Mouse)

  • Sequence: Encodes a 220-amino acid protein with seven predicted transmembrane domains .

Orthologs:

SpeciesGene IDSequence Identity (%)
Human13161664%
Rat36317167%
Dog60961164%

Recombinant Expression Systems

Recombinant Tmem42 is typically produced using lentiviral vectors for stable expression in mammalian cells (e.g., CHO-S). Key vectors include:

Lentiviral Constructs:

Vector NameTagSelection MarkerApplication
pLenti-C-mGFP-P2A-PuroC-terminal GFPPuromycinOverexpression, live imaging
pLenti-U6-sgRNA-PGK-NeoNoneNeomycinCRISPR activation (CRISPRa)

  • CRISPRa Utility: Lentivectors deliver three sgRNAs targeting the 5’ UTR of Tmem42, enabling transcriptional upregulation when paired with dCas9-VPR .

Antibodies:

ProductHostTarget RegionApplications
PA5-62641 (Thermo Fisher)RabbitHuman TMEM42 (aa 1–36)WB, IHC, ICC
HPA052569 (Sigma-Aldrich)RabbitFull-length Tmem42IHC

siRNA/shRNA:

  • esiRNA (EHU034491): Validated knockdown tool for human TMEM42 .

  • Custom shRNA: Available for mouse Tmem42 via Sigma-Aldrich .

Purification and Quality Control

Recombinant Tmem42 is purified using:

  1. Cation Exchange Chromatography: Isolates charged proteins.

  2. Size-Exclusion Chromatography: Ensures monodispersity .

Quality Metrics:

  • Purity: ≥95% (assessed by SDS-PAGE) .

  • Activity: Validated via TF-1/MTS assays (reference standard: rhNGF) .

Applications in Research

  1. Gene Overexpression: Lentiviral vectors enable stable Tmem42 expression in hard-to-transfect cells .

  2. Protein Interaction Studies: GFP-tagged Tmem42 facilitates subcellular localization tracking .

  3. Antibody Validation: Recombinant protein blocks nonspecific binding in IHC/WB .

Future Directions

  • Mechanistic Studies: Link Tmem42 to specific pathways (e.g., TGF-β, NF-κB) using CRISPRa models .

  • Disease Models: Explore roles in neurodegeneration or cancer using knockdown/overexpression systems .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during ordering for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline for your use.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer components, temperature, and protein stability. Generally, liquid forms have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Tmem42; Transmembrane protein 42
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-157
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Tmem42
Target Protein Sequence
MAAGPQSSGAAVSAAAYPDSPVELPARLQKGAMRRRFWGVFNCLCAGAFGALAAAAAKLA FGSQVNIGLCVLGIVAMASANSLMWTFFSRGLSFSMSSAIASVTVTFSNILCSAILGYLL YGECQEILWWGGVFLILCGLTLIHRKFPPTWKESKEQ
Uniprot No.
Q9CR22

Target Background

Database Links

KEGG: mmu:66079

STRING: 10090.ENSMUSP00000081784

UniGene: Mm.482265

Subcellular Location
Membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *

Category

Service

THE BIOTEK
THE BioTek is a global biotech company offering highly purified proteins for research in cancer, apoptosis, development, endocrinology, immunology, neuroscience, proteases, and stem cells.
  • Contact
  • Address: 1925 E Maple Ave, El Segundo, CA 90245 United States
  • Phone : +1 201-285-7826
  • Email : info@thebiotek.com
  • Hours : Mon.-Fri. 9:00 AM - 5:00 PM
© Copyright 2025 TheBiotek. All Rights Reserved.