Recombinant Mouse Transmembrane protein 50A (Tmem50a)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on several factors: storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C; lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us; we will prioritize its development.
Synonyms
Tmem50a; Smp1; Transmembrane protein 50A; Small membrane protein 1
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-157
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Tmem50a
Target Protein Sequence
MSGFLEGSRCSECMDWGEKRNTIASIAAGVLFFTGWWIIIDAAVMYPRMDQFNHSYHTCG VIATIAFLMINAVSNGQVRGDSYSEGCLGQTGARIWLFIGFMLAFGSLIASMWILFGGYV AKEKDVVYPGIAVFFQNAFIFFGGLVFKFGRTEDLWQ
Uniprot No.

Target Background

Database Links
Protein Families
UPF0220 family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is the predicted structure of mouse Tmem50a and how does it compare to human TMEM50A?

Mouse Tmem50a shares approximately 92% sequence identity with its human ortholog, making it an excellent model for translational research . Like human TMEM50A, mouse Tmem50a is predicted to have four transmembrane regions, which has been confirmed through multiple prediction programs and comparative analysis of orthologs . The protein likely functions as an integral membrane protein based on its sequence characteristics and predicted topology. Structural studies using TMHMM and other bioinformatic tools indicate conserved transmembrane domains with neutral charge properties across species . When designing experiments with recombinant mouse Tmem50a, researchers should consider these structural similarities when extrapolating findings to human systems.

What are the known functions of Tmem50a in mouse models?

While the complete functions of Tmem50a remain partially characterized, emerging evidence suggests it plays regulatory roles in gene expression. Studies examining human TMEM50A show that it affects the expression of nearby genes, particularly in the RH locus . When overexpressed, TMEM50A significantly upregulates RHCE gene activity by 63.56%, while inhibition decreases RHCE and RHD expression by 41.82% and 27.35%, respectively . Transcriptome analysis further suggests that Tmem50a affects transcription through splicing activities and may play important roles in embryonic nervous system development . Mouse models can help elucidate these functions more thoroughly through genetic manipulation approaches and detailed phenotypic characterization of knockout or overexpression models.

How is mouse Tmem50a post-translationally modified and what impact do these modifications have on function?

Bioinformatic analyses predict several post-translational modifications in TMEM50A that are likely conserved in mouse Tmem50a, including:

  • Two serine phosphorylation sites (corresponding to amino acids 82 and 84 in human TMEM50A)

  • One potential N-linked glycosylation site (corresponding to amino acid 74 in human TMEM50A)

  • One possible tyrosine phosphorylation site

These modifications potentially regulate Tmem50a function, membrane localization, protein-protein interactions, and stability. Researchers should consider incorporating phosphorylation-specific antibodies or glycosylation detection methods in their experimental designs when studying mouse Tmem50a function. Site-directed mutagenesis of these modification sites in recombinant constructs can help determine their functional significance.

What are the optimal expression systems for producing recombinant mouse Tmem50a?

For recombinant mouse Tmem50a production, mammalian expression systems (particularly mouse cell lines) generally yield protein with native post-translational modifications and proper folding. HEK293 cells have proven effective for membrane protein expression due to their high transfection efficiency and proper protein processing capabilities. When designing expression constructs, consider:

  • Including a cleavable tag (His, FLAG, or GST) for purification

  • Using a strong promoter (CMV or EF1α) for high expression

  • Incorporating a signal peptide if needed for proper membrane localization

  • Considering codon optimization for enhanced expression

For higher yields but potentially less native modifications, insect cell systems using baculovirus vectors offer an alternative. Bacterial systems generally prove challenging for transmembrane proteins due to improper folding and lack of post-translational modifications.

How can I effectively validate antibody specificity for mouse Tmem50a in my experiments?

Antibody validation for mouse Tmem50a requires multiple approaches to ensure specificity:

  • Blocking peptide control: Use a recombinant protein fragment (like commercially available aa 2-26 fragments) at 100x molar excess compared to antibody concentration. Pre-incubate the antibody-protein control mixture for 30 minutes at room temperature before application .

  • Genetic validation: Compare antibody reactivity in wild-type versus Tmem50a-knockout or knockdown samples (using siRNA as established in TMEM50A research models) .

  • Cross-reactivity testing: Evaluate potential cross-reactivity with related proteins, particularly in tissues where multiple transmembrane proteins are expressed.

  • Multiple antibody validation: Use antibodies targeting different epitopes of Tmem50a to confirm consistent localization and expression patterns.

Document all validation steps thoroughly in your experimental methods to ensure reproducibility and reliability of results.

What approaches are most effective for studying Tmem50a localization in mouse cells?

To study Tmem50a localization in mouse cells, consider the following methodological approaches:

  • Immunofluorescence microscopy: Use validated antibodies for IF(ICC) applications with appropriate co-staining for cellular compartments (plasma membrane, endoplasmic reticulum markers based on PSORT II predictions) .

  • Subcellular fractionation: Separate cellular compartments biochemically followed by Western blot detection of Tmem50a in different fractions.

  • Fluorescent protein tagging: Generate Tmem50a-GFP fusion constructs, ensuring tags don't disrupt transmembrane domains or functional regions.

  • Live-cell imaging: For dynamic localization studies, combine fluorescent tagging with time-lapse microscopy.

  • Electron microscopy: For high-resolution localization, use immunogold labeling with validated antibodies.

When designing these experiments, consider that prediction tools suggest Tmem50a localizes primarily to the plasma membrane or endoplasmic reticulum , which should guide your selection of appropriate markers and controls.

How can I effectively measure changes in Tmem50a expression in mouse models?

To accurately quantify Tmem50a expression changes:

  • RT-qPCR: Design primers spanning exon junctions to avoid genomic DNA amplification. Normalize to multiple reference genes that show stability in your experimental conditions.

  • Western blotting: Use validated antibodies with appropriate loading controls. For quantification, consider the following approach:

    • Load a standard curve of recombinant protein

    • Use fluorescent secondary antibodies for improved linear range

    • Normalize to total protein rather than single housekeeping proteins

  • RNA-seq: For transcriptome-wide analyses, include Tmem50a-specific analysis within your pipeline. This approach has successfully revealed Tmem50a's potential role in splicing and nervous system development .

  • Single-cell approaches: For tissue-specific expression patterns, consider single-cell RNA-seq or in situ hybridization techniques.

The table below summarizes the correlation values for genes co-expressed with tmem50a in zebrafish models, which might inform selection of control genes or potential interaction partners in mouse studies:

Positively Correlated Genesr ValueNegatively Correlated Genesr Value
tmeff1b0.160hbbe2-0.088
tubb50.150alas2-0.082
gnb1b0.149hbae1.3-0.082
jpt1b0.144si:ch211-250g4.3-0.082
hnrnpa0a0.138tmod4-0.082

This correlation data from zebrafish may provide insights for mouse studies, particularly considering evolutionary conservation of function.

What experimental approaches can determine whether mouse Tmem50a affects gene splicing?

To investigate Tmem50a's role in gene splicing, as suggested by transcriptome analysis :

  • RT-PCR splicing assays: Design primers flanking alternatively spliced exons in target genes (particularly RH genes) and analyze splice variant patterns after Tmem50a manipulation.

  • Minigene assays: Construct minigenes containing exons and introns of interest, co-transfect with Tmem50a expression vectors, and analyze splicing patterns.

  • RNA immunoprecipitation (RIP): Determine if Tmem50a associates with splicing factors or directly with pre-mRNAs using tagged Tmem50a constructs.

  • RNA-seq with splice junction analysis: Compare alternative splicing events genome-wide between Tmem50a-overexpressing, knockdown, and control samples. Focus analysis on percent spliced in (PSI) values and differential exon usage.

  • In vitro splicing assays: Using cell extracts with modulated Tmem50a levels to assess direct effects on splicing of target pre-mRNAs.

The methodology established in previous studies using K562 cell models with plasmid transfection and siRNA approaches provides a validated framework for these experiments .

How can I investigate the relationship between mouse Tmem50a and RH gene expression?

Based on established research showing TMEM50A's regulatory effects on RH genes , consider these methodological approaches:

  • Gene expression analysis after Tmem50a modulation: Utilize the established K562 cell model system with:

    • Transfection of Tmem50a expression plasmids for overexpression studies

    • siRNA-mediated knockdown for loss-of-function studies

    • Measure RH gene expression changes via RT-qPCR and Western blot

  • mRNA stability assays: Treat cells with transcription inhibitors (actinomycin D) and measure RH mRNA half-life in Tmem50a-modulated versus control cells to test the hypothesis that Tmem50a affects mRNA stability.

  • Promoter reporter assays: Clone RH gene promoters into luciferase reporter constructs and co-transfect with Tmem50a to assess transcriptional regulation.

  • Chromatin immunoprecipitation (ChIP): Determine whether Tmem50a associates with chromatin at RH gene loci, potentially through interactions with transcription factors.

Previous research demonstrated that TMEM50A overexpression significantly upregulated RHCE gene activity by 63.56%, while inhibition decreased RHCE and RHD expression by 41.82% and 27.35%, respectively . These values provide important benchmarks for expected effect sizes in mouse models.

How can I study the potential role of mouse Tmem50a in nervous system development?

Transcriptome analysis has suggested that TMEM50A plays a role in embryonic nervous system development . To investigate this function in mouse models:

  • Conditional knockout models: Generate nervous system-specific Tmem50a knockout mice using Cre-lox systems with neural-specific promoters (Nestin-Cre, GFAP-Cre).

  • Neural differentiation assays: Use mouse embryonic stem cells or neural progenitor cells with Tmem50a modulation to assess effects on:

    • Neuronal differentiation markers

    • Neurite outgrowth and morphology

    • Electrophysiological properties

    • Synaptic formation

  • In utero electroporation: Deliver Tmem50a overexpression or knockdown constructs to developing mouse brains to assess effects on:

    • Neuronal migration

    • Cortical layering

    • Dendrite formation

  • Single-cell transcriptomics: Analyze neural cell populations during development with varying Tmem50a expression levels to identify cell-type-specific effects.

  • Behavioral testing: Assess neurological phenotypes in Tmem50a-modified mouse models using standardized behavioral tests relevant to neurodevelopmental disorders.

What are the best approaches for resolving contradictory data in Tmem50a functional studies?

When faced with contradictory results in Tmem50a research:

How can protein-protein interaction studies enhance our understanding of mouse Tmem50a function?

To identify and characterize Tmem50a interaction partners:

  • Co-immunoprecipitation: Use tagged Tmem50a constructs or antibodies against endogenous protein, followed by mass spectrometry to identify interacting proteins.

  • Proximity labeling: Apply BioID or APEX approaches with Tmem50a fusion proteins to identify proximal proteins in living cells.

  • Yeast two-hybrid screening: Use Tmem50a domains (avoiding transmembrane regions) as bait to screen mouse cDNA libraries.

  • Split-reporter complementation assays: Apply BiFC or NanoBiT systems to verify and visualize specific interactions in living cells.

  • Crosslinking mass spectrometry: Use chemical crosslinkers to capture transient interactions followed by mass spectrometry analysis.

When designing these experiments, consider Tmem50a's membrane topology and ensure that tags or fusion proteins do not disrupt the native structure. The four transmembrane domains suggest that both N- and C-termini may be available for interactions in the same cellular compartment, while the intervening loops may interact with proteins in other compartments.

What quality control parameters should I verify when working with recombinant mouse Tmem50a?

To ensure experimental reproducibility with recombinant mouse Tmem50a:

  • Protein purity assessment:

    • SDS-PAGE with Coomassie staining (>90% purity recommended)

    • Western blot confirmation of identity

    • Mass spectrometry verification

  • Functional validation:

    • Proper folding verification using circular dichroism

    • Activity assays based on known functions (e.g., effects on RH gene expression)

    • Binding studies with known interaction partners

  • Stability testing:

    • Thermal stability analysis

    • Freeze-thaw stability assessment

    • Long-term storage condition optimization

  • Endotoxin testing: Particularly crucial for immunological studies, use LAL assays to confirm endotoxin levels below 0.1 EU/μg protein.

  • Batch consistency: Implement lot-to-lot comparison protocols to ensure experimental reproducibility across production batches.

Document all quality control parameters thoroughly in your methods sections to enhance reproducibility across research groups.

What controls are essential when studying the effects of recombinant mouse Tmem50a in experimental systems?

When designing experiments with recombinant mouse Tmem50a, include these essential controls:

  • Expression controls:

    • Empty vector controls for overexpression studies

    • Non-targeting siRNA/shRNA for knockdown studies

    • qPCR and Western blot verification of expression levels

  • Specificity controls:

    • Blocking peptide controls for antibody experiments (use 100x molar excess)

    • Rescue experiments with siRNA-resistant constructs

    • Multiple independent siRNAs/shRNAs targeting different regions

  • Functional controls:

    • Positive controls with known effects (e.g., manipulations known to affect RH gene expression)

    • Negative controls with no expected effect

    • Dose-response experiments to establish specificity

  • Localization controls:

    • Co-staining with compartment markers (ER, plasma membrane)

    • Controls for antibody specificity in immunofluorescence

  • Experimental condition controls:

    • Time-course experiments to determine optimal timing

    • Cell type-specific effects validation across multiple cell lines

When monitoring ammonium transport function related to RH genes, include appropriate pH monitoring controls as established in previous studies .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.