Recombinant Mouse Transmembrane protein 50B (Tmem50b)

Shipped with Ice Packs
In Stock

Description

Definition and Biological Significance

Tmem50b is a multi-pass transmembrane protein belonging to the UPF0220 family . It is highly expressed in glial cells, neural precursor cells, and specific cerebellar neurons (e.g., Purkinje cells) . Its recombinant form retains structural and functional characteristics, enabling studies on its role in:

  • Brain development: Regulation of neural precursor cell differentiation and glial function .

  • Subcellular trafficking: Involvement in late endosome-to-vacuole transport via multivesicular body sorting pathways .

Recombinant Production Systems

Recombinant Tmem50b is produced using diverse expression platforms, each optimized for specific downstream applications:

Table 1: Expression Systems for Recombinant Mouse Tmem50b

SystemPromoter/TagPurityApplicationsSource
HEK293 CellsHis/Fc/Avi-tag≥85%Immunoprecipitation, assays
YeastPartial sequence>85%Antibody validation
LentivirusCMV promoterN/AStable cell line generation

Key features include:

  • Lentiviral vectors: Enable CMV-driven expression in mammalian cells, with inserts flanked by NheI and XhoI restriction sites for flexibility .

  • Tagged variants: His/Fc/Avi tags facilitate purification and detection in assays .

Table 2: Biophysical and Functional Data

PropertyDetailSource
Molecular Weight~23 kDa (observed); 18 kDa (predicted)
UniProt IDQ9D1X9 (Mouse)
Isoelectric PointNot reported-
Post-Translational ModificationsLikely glycosylation (predicted)
  • Cross-species reactivity: Antibodies against Tmem50b show 100% sequence identity with mouse, rat, and human orthologs .

  • Stability: Lyophilized forms remain stable for 12 months at -80°C; liquid forms last 6 months under similar conditions .

Expression Patterns

  • Developmental regulation: Tmem50b mRNA peaks postnatally in the cerebellum, hippocampus, and olfactory bulb .

  • Cellular localization: Confirmed via electron microscopy in ER and Golgi membranes .

Functional Insights

  • Neural precursor cells: Essential for maintaining precursor cell populations in vitro .

  • Glial interactions: Bergmann glia in the cerebellum show high Tmem50b expression, suggesting roles in synaptic support .

Experimental Tools

  • siRNA knockdown: Pre-designed siRNA duplexes (e.g., MyBioSource MBS8240047) achieve >97% knockdown efficiency in mouse models .

  • Antibody validation: Anti-Tmem50b antibodies (e.g., Boster Bio A14199-1) detect a 23 kDa band in Western blots across species .

Applications in Research

Recombinant Tmem50b is utilized in:

  • Immunoassays: Pre-coupled magnetic beads streamline immunoprecipitation and cell sorting .

  • Protein interaction studies: His/Fc-tagged variants enable pull-down assays .

  • Disease modeling: Lentiviral vectors aid in studying Tmem50b overexpression in neurodevelopmental disorders .

Challenges and Considerations

  • Expression variability: HEK293 systems may require optimization for high-yield production .

  • Antibody cross-reactivity: Despite high sequence homology, species-specific validation is recommended .

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you require a specific format, please indicate your preference in the order notes. We will fulfill your request as much as possible.
Lead Time
Delivery times may vary based on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: All of our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please contact us in advance, as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure all contents are at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we suggest adding 5-50% glycerol (final concentration) and aliquoting the solution at -20°C/-80°C. Our standard final concentration of glycerol is 50%. Customers can use this as a reference.
Shelf Life
Shelf life can be influenced by several factors, including storage conditions, buffer ingredients, temperature, and the protein's intrinsic stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple use. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
If you have a specific tag type in mind, please let us know, and we will prioritize developing the specified tag.
Synonyms
Tmem50b; Transmembrane protein 50B
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-158
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Tmem50b
Target Protein Sequence
MAGFLDNFRWPECECIDWSERRNTVASVVAGILFFTGWWIMIDAAVVYPKPEQLNHAFHT CGVFSTLAFFMINAVSNAQVRGDSYESGCLGRTGARVWLFIGFMLMFGSLIASMWILFGA YVTQNIDVYPGLAVFFQNALIFFSTLIYKFGRTEELWA
Uniprot No.

Target Background

Gene References Into Functions
  1. Tmem50b is a developmentally regulated intracellular ER and Golgi apparatus membrane protein that may play a crucial role in proper brain development. Its functions are likely associated with precursor cells and glia. PMID: 18541381
Database Links
Protein Families
UPF0220 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein. Golgi apparatus membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in brain, heart and testis (at protein level). In the cerebellum, has particularly strong expression in Bergmann astroglial cells (at protein level).

Q&A

What is Tmem50b and what protein family does it belong to?

Tmem50b (Transmembrane protein 50B), also known previously as C21orf4, is a predicted transmembrane protein that belongs to the UPF0220 family . It encodes a protein that has been identified as significantly over-expressed during cerebellar development in a Down syndrome mouse model (Ts1Cje) . The human TMEM50B protein consists of 158 amino acids and functions as an integral membrane protein . It has been predicted to be involved in late endosome to vacuole transport via multivesicular body sorting pathway . The gene is located on chromosome 21q22.11 in humans, which is particularly significant given its potential role in Down syndrome, a condition caused by trisomy of chromosome 21 . Understanding this protein's structure is essential for elucidating its functional mechanisms in normal development and disease states.

Where is Tmem50b expressed in mouse tissues?

Tmem50b exhibits a diverse expression pattern that varies both spatially and temporally during development. In situ hybridization studies in mice at embryonic day 14.5 have shown Tmem50b mRNA expression in the cortical plate and spinal cord . By postnatal day 7, strong mRNA expression becomes apparent in the cerebellum, hippocampus, and olfactory bulb, with diffuse expression throughout the cortex . Quantitative PCR analysis of adult mouse tissue has revealed Tmem50b mRNA expression primarily in the brain, heart, and testis . At the cellular level, double immunofluorescence studies have demonstrated that Tmem50b is highly expressed in glial fibrillary acidic protein (GFAP)-positive cells (glial cells) both in vivo and in vitro, while showing lower expression in neuronal MAP2- or beta-tubulin II-positive cells in vitro . Within the adult mouse cerebellum, Tmem50b immunoreactivity has been specifically localized to Purkinje and Golgi cell somata as well as in Bergmann glial processes . Notably, Tmem50b is consistently expressed in cultured mouse neural precursor cells, suggesting a role in neural development .

What is the subcellular localization of Tmem50b?

The subcellular localization of Tmem50b has been conclusively determined through electron microscopy studies, which have confirmed that this protein is present on endoplasmic reticulum (ER) and Golgi apparatus membranes . This intracellular membrane localization provides important insights into the potential functions of Tmem50b. As an ER and Golgi resident protein, Tmem50b may be involved in protein processing, maturation, and trafficking within the secretory pathway . This localization pattern is consistent with the protein's predicted function in late endosome to vacuole transport via the multivesicular body sorting pathway, as noted in more recent annotations . The specific localization to these organelles suggests that Tmem50b likely plays a role in cellular processes such as protein quality control, membrane organization, or vesicular transport, which are essential for proper cellular function, particularly in specialized cells like neurons and glia during development .

What methods are optimal for detecting Tmem50b expression in tissue samples?

For comprehensive detection of Tmem50b expression in tissue samples, researchers should employ a multi-modal approach combining both mRNA and protein detection techniques. In situ hybridization has proven effective for visualizing Tmem50b mRNA expression patterns in developmental contexts, as demonstrated in studies of mouse embryos at E14.5 and postnatal day 7 . For quantitative assessment of mRNA levels across different tissues, quantitative PCR (qPCR) is recommended and has successfully shown differential expression in brain, heart, and testis in adult mice . At the protein level, immunohistochemistry using a specific polyclonal antibody against Tmem50b provides detailed information about tissue and cellular distribution patterns . For higher resolution analysis, double immunofluorescence combining Tmem50b antibodies with cell-type specific markers (such as GFAP for glial cells or MAP2/beta-tubulin II for neurons) allows precise identification of expressing cell populations . Western blot analysis serves as an important validation method to confirm antibody specificity and provides semi-quantitative information about protein expression levels across different tissues . For the most detailed subcellular localization studies, electron microscopy with immunogold labeling has successfully localized Tmem50b to ER and Golgi membranes .

How can recombinant Tmem50b be produced for experimental studies?

Production of recombinant Tmem50b for experimental studies requires careful consideration of expression systems and purification strategies due to its transmembrane nature. While the search results don't specifically detail production methods for recombinant Tmem50b, insights can be gained from related recombinant transmembrane proteins. Based on protocols for similar proteins, researchers should consider mammalian expression systems (such as HEK293 or CHO cells) to ensure proper folding and post-translational modifications . For recombinant production, the full-length coding sequence or the extracellular domain with an appropriate tag (such as HA-tag as used with VSTM2L) could be cloned into a suitable expression vector . Purification typically involves detergent solubilization of membranes followed by affinity chromatography using the added tag . For functional studies, researchers should determine whether to produce the full-length protein or specific domains based on experimental requirements. Quality control should include SDS-PAGE under both reducing and non-reducing conditions to assess proper folding and potential disulfide bond formation, similar to protocols used for other recombinant proteins . For reconstitution, if the protein is lyophilized, researchers should follow careful reconstitution protocols similar to those used for other recombinant proteins (e.g., reconstituting at 100 μg/mL in PBS) .

What are the best approaches for studying Tmem50b function in vitro?

To elucidate Tmem50b function in vitro, researchers should employ a combination of overexpression, knockdown, and localization studies in relevant cell models. For overexpression studies, transfection of Tmem50b expression constructs into neural cell lines or primary neural cells would allow assessment of effects on cellular morphology, differentiation, and organelle structure . Conversely, RNA interference (siRNA or shRNA) or CRISPR-Cas9 approaches to knockdown or knockout Tmem50b can reveal loss-of-function phenotypes . Co-localization studies using fluorescently tagged Tmem50b along with markers for ER, Golgi, and various vesicular compartments would further define its subcellular dynamics and trafficking patterns . To explore potential protein interactions suggested by computational analyses, co-immunoprecipitation followed by mass spectrometry could identify binding partners, with particular attention to predicted functional partners like LEPROTL1 and LEPROT, which show high interaction scores (0.866 and 0.861 respectively) . For functional studies related to vesicular transport, live-cell imaging with fluorescently tagged Tmem50b would allow tracking of protein movement through the secretory pathway . Given Tmem50b's association with neural precursor cells, differentiation assays using neural stem cells with modulated Tmem50b expression could reveal roles in cell fate determination or maturation .

How does Tmem50b contribute to Down syndrome phenotypes?

Tmem50b has been identified as one of the few genes significantly overexpressed during cerebellar development in the Ts1Cje mouse model of Down syndrome, suggesting a potential role in the pathophysiology of this condition . The gene's location on human chromosome 21q22.11 places it in the critical region associated with Down syndrome phenotypes . Research indicates that altered expression of Tmem50b might contribute to neurodevelopmental abnormalities characteristic of Down syndrome through several potential mechanisms. First, given its high expression in neural precursor cells and glial cells, Tmem50b overexpression may disrupt the normal balance of neural cell proliferation, differentiation, or migration during critical developmental windows . Second, as an ER and Golgi apparatus membrane protein, excessive Tmem50b could alter protein processing, folding, or trafficking in these compartments, potentially contributing to cellular stress responses that may be detrimental to developing neural tissues . Third, the timing of Tmem50b expression during cerebellar development coincides with periods of significant neuronal migration and synaptic refinement, suggesting that abnormal levels might impair these processes . Genetic association studies have also linked TMEM50B to cognitive performance, further supporting its potential role in intellectual disability associated with Down syndrome .

What role does Tmem50b play in brain development?

Tmem50b appears to play a critical role in brain development based on its spatiotemporal expression pattern and cellular localization. The protein shows a developmentally regulated expression profile, with in situ hybridization studies revealing early expression in the cortical plate and spinal cord at embryonic day 14.5, followed by strong expression in the cerebellum, hippocampus, and olfactory bulb by postnatal day 7 . This timing coincides with critical periods of neurogenesis, cell migration, and circuit formation in these regions. The protein's invariable expression in cultured mouse neural precursor cells suggests it may regulate aspects of neural stem cell maintenance, proliferation, or differentiation . At the cellular level, Tmem50b is highly expressed in glial cells (GFAP-positive) both in vivo and in vitro, indicating a potential role in glial function or glial-neuronal interactions that are crucial for proper brain development . Within the cerebellum, Tmem50b is found in Purkinje and Golgi cell somata and Bergmann glial processes, suggesting involvement in cerebellar circuit development and function . As an ER and Golgi apparatus membrane protein, Tmem50b may regulate protein processing or membrane organization necessary for neuronal and glial morphogenesis, potentially influencing processes such as neurite outgrowth, synaptogenesis, or myelination during development .

What are the known protein interactions of Tmem50b?

Protein interaction analyses have identified several potential functional partners of Tmem50b, providing insights into its possible cellular functions. According to STRING database interaction network analysis, TMEM50B shows highest predicted functional partnerships with LEPROTL1 (Leptin receptor overlapping transcript-like 1) and LEPROT (Leptin receptor gene-related protein), with interaction scores of 0.866 and 0.861 respectively . These proteins negatively regulate cell surface expression of growth hormone and leptin receptors, suggesting a potential role for TMEM50B in receptor trafficking or surface expression regulation . Other predicted interaction partners include DONSON (Protein downstream neighbor of Son) with a score of 0.641, which functions in protecting stalled or damaged replication forks and maintaining genome stability . GART (Trifunctional purine biosynthetic protein adenosine-3) shows an interaction score of 0.598 and is involved in purine biosynthesis . Additional interactors include MRPS6 (Mitochondrial ribosomal protein S6, score 0.588), DNAJC28 (DnaJ homolog subfamily C member 28, score 0.580) which may function as a chaperone, and CRYZL1 (Quinone oxidoreductase-like protein 1, score 0.515) . These interactions suggest potential roles for Tmem50b in processes including receptor trafficking, protein folding, genome stability, and metabolic regulation, though experimental validation of these computational predictions is necessary .

How to address inconsistent Tmem50b expression patterns in experiments?

When encountering inconsistent Tmem50b expression patterns across experiments, researchers should implement a systematic troubleshooting approach. First, verify antibody specificity through multiple validation methods including Western blotting with positive and negative controls, as well as peptide blocking experiments to confirm binding specificity . Second, ensure consistent tissue collection and processing protocols, as variability in fixation times, processing temperatures, or antigen retrieval methods can significantly affect immunodetection results . For mRNA analysis, optimize RNA extraction procedures to minimize degradation and validate primer specificity for qPCR applications . Consider developmental timing carefully, as Tmem50b shows dynamic expression changes during development—at embryonic day 14.5, expression is limited to cortical plate and spinal cord, while by postnatal day 7, expression extends to cerebellum, hippocampus, and olfactory bulb . Cell-type heterogeneity within samples can lead to apparent inconsistencies; therefore, employ cell sorting or single-cell techniques when possible, or use double-labeling with cell-type specific markers to identify expressing populations precisely . When comparing across studies, account for strain-specific differences in mice, as background genotype can influence gene expression patterns . For recombinant protein work, verify protein quality and concentration using multiple methods including SDS-PAGE under both reducing and non-reducing conditions to assess proper folding and potential aggregation .

What controls should be used when studying Tmem50b in cellular models?

Robust experimental design for Tmem50b studies in cellular models requires comprehensive controls to ensure valid and reproducible results. For immunocytochemistry and immunohistochemistry, primary antibody controls should include omission of primary antibody, pre-adsorption with immunizing peptide, and tissues from knockout models when available . When overexpressing Tmem50b, employ both empty vector controls and overexpression of an unrelated protein of similar size and localization to distinguish specific from non-specific effects . For knockdown experiments, utilize non-targeting siRNA/shRNA sequences as negative controls and rescue experiments with RNAi-resistant Tmem50b constructs to confirm specificity . When examining Tmem50b in specific cell types like glial cells or neural precursors, include appropriate cell-type specific markers (GFAP for astrocytes, MAP2 or beta-tubulin III for neurons) in parallel staining to verify cell identity . For subcellular localization studies, include co-staining with established markers for ER (e.g., calnexin) and Golgi apparatus (e.g., GM130) to confirm organelle identity . In developmental studies, analyze multiple timepoints and include age-matched wild-type controls . For protein interaction studies with predicted partners like LEPROTL1 or LEPROT, confirm interactions through multiple methods (co-immunoprecipitation, proximity ligation assay) and include unrelated proteins as negative controls .

How to interpret contradictory data on Tmem50b function?

When confronted with contradictory data regarding Tmem50b function, researchers should employ a multi-faceted analytical approach to resolve inconsistencies. Begin by critically evaluating methodological differences between studies, including experimental systems (in vivo versus in vitro), cell types (neural precursors versus differentiated cells), developmental stages, and detection methods . Consider species differences, as studies in mouse models may not directly translate to human systems due to potential differences in expression patterns or interacting partners . Analyze the cellular context carefully, as Tmem50b shows differential expression between glial cells and neurons, which may result in cell-type specific functions that appear contradictory when not properly contextualized . Evaluate potential compensatory mechanisms, particularly in knockout models, where related proteins such as TMEM50A might functionally compensate for loss of Tmem50b . Examine the subcellular localization data carefully, as Tmem50b's presence in both ER and Golgi membranes suggests it may have distinct functions in different compartments . For studies examining Tmem50b in Down syndrome models, consider gene dosage effects and interactions with other triplicated genes on chromosome 21 that might modify Tmem50b function in this context . When interpreting protein interaction data, recognize that computational predictions (like those from STRING database) require experimental validation and may represent indirect rather than direct interactions .

What are the unexplored aspects of Tmem50b function?

Despite progress in characterizing Tmem50b expression and localization, numerous critical aspects of its function remain unexplored and warrant investigation. The molecular mechanisms by which Tmem50b contributes to Down syndrome phenotypes have not been fully elucidated, particularly how its overexpression affects neural precursor proliferation, differentiation, or migration . The functional significance of Tmem50b's interactions with predicted partners like LEPROTL1 and LEPROT requires experimental validation, especially regarding potential roles in receptor trafficking or endosomal sorting . The temporal regulation of Tmem50b expression during development needs further characterization, including identification of transcription factors and epigenetic mechanisms controlling its expression in different cell types and developmental stages . The precise role of Tmem50b in glial cells, where it shows high expression, remains largely unknown, particularly regarding potential functions in glial-neuronal communication, metabolic support, or myelination . While Tmem50b is predicted to be involved in late endosome to vacuole transport via multivesicular body sorting, the specific cargo molecules it might regulate remain unidentified . The potential involvement of Tmem50b in other neurological disorders beyond Down syndrome merits exploration, particularly given its association with cognitive performance in genome-wide studies . Additionally, the reported association of TMEM50B with inflammatory bowel disease suggests unexplored functions in immune regulation or epithelial barrier function that deserve investigation .

How can advanced technologies enhance Tmem50b research?

Advanced technologies offer unprecedented opportunities to deepen our understanding of Tmem50b's functions and mechanisms. Single-cell RNA sequencing can reveal cell-type specific expression patterns with higher resolution than conventional methods, potentially identifying previously unrecognized cell populations expressing Tmem50b in the developing and adult brain . CRISPR-Cas9 genome editing enables precise modification of Tmem50b in both cellular and animal models, allowing creation of knockout, knockin, or domain-specific mutations to dissect functional domains . For protein interaction studies, proximity labeling techniques like BioID or APEX2 can identify Tmem50b's proximal interactome within specific subcellular compartments like ER or Golgi membranes . Super-resolution microscopy (STORM, PALM, or SIM) can provide nanoscale visualization of Tmem50b's precise localization within membrane subdomains of the ER and Golgi, potentially revealing functional microdomains . Cryo-electron microscopy could elucidate the three-dimensional structure of Tmem50b, providing insights into its membrane topology and potential interaction interfaces . Organoid technologies derived from human induced pluripotent stem cells with manipulated TMEM50B expression can model developmental processes in a human context, particularly relevant for Down syndrome research . Optical control of Tmem50b using optogenetic approaches could enable temporal manipulation of its function to dissect its roles in dynamic cellular processes . Mass spectrometry-based proteomics approaches could identify post-translational modifications of Tmem50b and how these regulate its function, trafficking, or interactions .

What is the translational potential of Tmem50b research?

Research on Tmem50b holds significant translational potential, particularly for neurodevelopmental disorders and beyond. Given its overexpression in Down syndrome models and its location on chromosome 21, Tmem50b represents a potential therapeutic target for ameliorating specific aspects of Down syndrome neuropathology . Understanding Tmem50b's role in neural precursor cells could inform strategies for neural regeneration or repair in various neurological conditions, leveraging its apparent functions in developmental processes . The protein's presence in glial cells suggests potential applications in addressing glial dysfunction in conditions ranging from neurodevelopmental disorders to neurodegenerative diseases and neurotrauma . If Tmem50b indeed functions in vesicular transport pathways as predicted, it might serve as a target for modulating protein trafficking, with potential applications in diseases characterized by protein misfolding or trafficking defects . The genetic association between TMEM50B and inflammatory bowel disease suggests explorations of its function could yield insights into intestinal homeostasis and inflammation, potentially informing therapeutic approaches for IBD . Developing antibodies or small molecules targeting Tmem50b or its interactions could provide research tools that might eventually evolve into therapeutic candidates . Biomarker applications might emerge if Tmem50b expression patterns correlate with disease states or developmental abnormalities, potentially aiding in diagnosis or monitoring . Additionally, the apparent role of Tmem50b in cognitive performance suggests potential applications in addressing cognitive deficits across various neurological and psychiatric conditions .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.