Recombinant Mouse Transmembrane protein 51 (Tmem51)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during ordering for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Tmem51; Transmembrane protein 51
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-249
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Tmem51
Target Protein Sequence
MMAQSKANGSHYALTAIGLGMLVLGVIMAMWNLVPGFSPADKPTSQGNKTEGGGGILKSK TFSVAYVLVGAGMMLLLLAICLSIRDKRRMRQSEELARIQQQAGTVPHSQEEDSQEEEED VSSRYYVPSYEEVMNTGYPETRGQEQNPRLSISLPSYESLTGLDEATPTSTRAETETSPG HAPDRQNSKLAKRLKPLKVRRIKSEKLHLKDFRITLPDKNVPPPSIEPLTPPPLYDEVQA KAPDARPPD
Uniprot No.

Target Background

Database Links
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

How conserved is Tmem51 between mouse and human models?

Tmem51 exhibits considerable evolutionary conservation between mouse and human orthologs, suggesting functional importance. Sequence alignment analyses show conserved domains that likely contribute to the protein's core functions. When designing experimental approaches, researchers should consider cross-species conservation when extrapolating findings between model systems. Comparative genomic approaches may help identify critical functional domains when planning recombinant protein truncation studies.

What cellular localization patterns are observed for mouse Tmem51?

Mouse Tmem51 predominantly localizes to membrane compartments, consistent with its predicted transmembrane domains. When expressing recombinant Tmem51, researchers should verify proper subcellular localization using fluorescent tagging approaches such as GFP fusion proteins or immunofluorescence with appropriate antibodies against either native protein or epitope tags. Comparison with endogenous localization patterns should be performed to ensure recombinant constructs maintain proper trafficking.

What expression systems are optimal for recombinant mouse Tmem51 production?

The choice of expression system for recombinant mouse Tmem51 depends on research objectives. For structural studies requiring high yields, bacterial systems (E. coli) may be used for specific domains, though proper folding of transmembrane regions often requires eukaryotic systems. Mammalian expression systems (HEK293, CHO cells) generally provide better folding and post-translational modifications but at lower yields. Insect cell systems (Sf9, High Five) offer a compromise between yield and proper folding for transmembrane proteins. When selecting an expression system, consider:

Expression SystemAdvantagesDisadvantagesBest For
E. coliHigh yield, simple, cost-effectiveLimited post-translational modifications, inclusion body formationSoluble domains, high-throughput screening
Mammalian cellsNative-like folding, proper post-translational modificationsLower yield, higher cost, time-consumingFunctional studies, antibody production
Insect cellsModerate to high yield, eukaryotic processingGlycosylation patterns differ from mammalsStructural studies, protein-protein interactions
Cell-freeRapid, handles toxic proteinsExpensive, limited post-translational modificationsPreliminary screening, truncation variants

How should fusion tags be selected for optimal solubility and purification of recombinant Tmem51?

Transmembrane proteins like Tmem51 often present solubility challenges. Selection of appropriate fusion tags can enhance both expression and purification efficiency. Consider these methodological approaches:

  • N-terminal tags are generally preferred for transmembrane proteins to avoid interfering with membrane insertion

  • For initial purification, larger solubility-enhancing tags such as MBP (maltose-binding protein) or GST (glutathione S-transferase) may improve yield

  • For structural studies, smaller tags like 6xHis or FLAG are preferred

  • Include protease cleavage sites between the tag and target protein

  • Consider dual tagging strategies (e.g., His-MBP) for multi-step purification

For functional studies, verify that the selected tag does not interfere with protein activity through comparative analyses with differently tagged constructs or tag-free protein.

What membrane protein extraction methods are most effective for recombinant Tmem51?

Extraction of transmembrane proteins requires careful selection of detergents and solubilization conditions. For recombinant mouse Tmem51, researchers should consider:

  • Initial screening of multiple detergents including mild (DDM, LMNG), moderate (OG, LDAO), and harsh (SDS, Triton X-100) detergents

  • Optimization of detergent concentration, typically starting at 2-3× critical micelle concentration (CMC)

  • Buffer composition including salt concentration (typically 150-300 mM NaCl) and pH (typically 7.0-8.0)

  • Addition of stabilizers such as glycerol (5-10%) or specific lipids

  • Temperature control during extraction (4°C is standard)

Following extraction, purification strategies should maintain the selected detergent above its CMC throughout all chromatography steps to prevent protein aggregation.

How is Tmem51-AS1 related to Tmem51 function, and what implications does this have for research?

TMEM51-AS1 is a long non-coding RNA (lncRNA) that is transcribed from the antisense strand of the TMEM51 gene. Research has shown that TMEM51-AS1 can function as a competing endogenous RNA (ceRNA) in certain cancer types such as laryngeal squamous cell carcinoma (LSCC) . This lncRNA appears to be regulated by methylation and may function by sponging miR-106b to regulate downstream targets including SNX21 and TRAPPC10 .

When studying mouse Tmem51, researchers should consider potential regulatory relationships with antisense transcripts. Experimental designs might include:

  • RT-qPCR analysis of both Tmem51 and potential antisense transcripts

  • Evaluation of methylation status in the genomic region

  • Assessment of potential miRNA binding sites in Tmem51 mRNA

  • Investigation of coordinated or antagonistic expression patterns

Understanding these relationships may provide insights into post-transcriptional regulation of Tmem51 expression and function.

What experimental approaches can determine protein-protein interactions involving Tmem51?

To identify and characterize protein-protein interactions involving recombinant mouse Tmem51, researchers can employ several complementary methodologies:

  • Co-immunoprecipitation (Co-IP) using antibodies against Tmem51 or epitope tags

  • Proximity labeling approaches such as BioID or APEX to identify proteins in spatial proximity

  • Yeast two-hybrid screening with soluble domains of Tmem51

  • Pull-down assays using recombinant Tmem51 as bait

  • Surface plasmon resonance (SPR) or bio-layer interferometry (BLI) for quantitative binding kinetics

When designing these experiments, consider membrane protein-specific challenges:

  • Maintain proper detergent conditions throughout purification and binding experiments

  • Include appropriate negative controls with other membrane proteins

  • Validate interactions through multiple independent methods

  • Consider crosslinking approaches to stabilize transient interactions

How can differential expression of Tmem51 in mouse tissues inform functional studies?

Understanding the tissue-specific expression patterns of Tmem51 can provide valuable insights into its potential physiological roles. Researchers should consider:

  • Performing RT-qPCR analysis across multiple tissue types and developmental stages

  • Consulting transcriptomic databases for existing expression data

  • Using immunohistochemistry to verify protein-level expression patterns

  • Investigating expression changes in disease models or under various stressors

These expression profiles can guide hypotheses about functional significance and help prioritize tissues for further investigation, especially when studying phenotypes in genetic models.

How can researchers address aggregation issues when working with recombinant Tmem51?

Transmembrane proteins frequently encounter aggregation challenges during recombinant expression and purification. For mouse Tmem51, consider these methodological solutions:

  • Optimize detergent selection through systematic screening of different detergent classes

  • Implement size exclusion chromatography (SEC) as a final purification step to separate monomeric protein from aggregates

  • Add stabilizing agents such as specific lipids, cholesterol, or glycerol to purification buffers

  • Explore protein engineering approaches such as thermostabilizing mutations or removal of flexible regions

  • Consider reconstitution into nanodiscs, liposomes, or other membrane mimetics for functional studies

Analytical techniques such as dynamic light scattering (DLS), SEC-MALS (multi-angle light scattering), and negative-stain electron microscopy should be employed to assess protein homogeneity and aggregation state.

How can CRISPR-Cas9 technology be applied to study Tmem51 function in mouse models?

CRISPR-Cas9 genome editing provides powerful approaches for investigating Tmem51 function:

  • Design multiple sgRNAs targeting early exons of mouse Tmem51 gene

  • Validate editing efficiency in mouse cell lines before attempting germline modification

  • Consider conditional knockout strategies using Cre-loxP or similar systems if complete knockout is lethal

  • For structure-function studies, design knock-in strategies to introduce specific mutations or epitope tags

  • For studying transcript regulation, target the promoter region or potential regulatory elements

Following genome editing, comprehensive validation should include:

  • DNA sequencing to confirm intended modifications

  • RT-qPCR and Western blotting to verify changes in expression

  • Phenotypic characterization across multiple physiological systems

  • Rescue experiments with recombinant Tmem51 to confirm specificity

What approaches can resolve contradictory findings in Tmem51 functional studies?

When encountering contradictory results in Tmem51 research, systematic troubleshooting approaches include:

  • Carefully evaluate model systems used across studies (cell types, species differences)

  • Assess expression levels of recombinant protein compared to endogenous levels

  • Consider post-translational modifications that may be differentially present

  • Evaluate buffer conditions, particularly detergents used for membrane protein studies

  • Examine the specific protein constructs used (full-length vs. truncated, tag position)

  • Analyze the sensitivity and specificity of detection methods

A structured approach to reconciling contradictory findings might include replication studies using standardized protocols, collaborative cross-laboratory validation, and meta-analysis of multiple independent studies to identify consistent patterns despite methodological differences.

How might single-cell approaches advance understanding of Tmem51 function?

Single-cell technologies offer novel insights into cellular heterogeneity that may be particularly relevant for transmembrane proteins like Tmem51:

  • Single-cell RNA-seq can reveal cell type-specific expression patterns not evident in bulk analysis

  • Single-cell proteomics approaches can identify co-expression patterns with potential interaction partners

  • Live-cell imaging of fluorescently tagged Tmem51 can track dynamic subcellular localization

  • Single-molecule tracking can reveal membrane diffusion dynamics and potential clustering

These approaches may be particularly valuable for understanding Tmem51 function in heterogeneous tissues or during developmental transitions where bulk measurements might mask important cell type-specific effects.

What are the most promising approaches for developing specific antibodies against mouse Tmem51?

Development of specific antibodies against transmembrane proteins presents unique challenges. For mouse Tmem51, researchers should consider:

  • Identifying antigenic epitopes in extracellular loops or N/C-terminal domains

  • Using recombinant protein fragments rather than synthetic peptides as immunogens

  • Implementing phage display or similar in vitro selection methods to obtain high-affinity binders

  • Rigorous validation in knockout models to confirm specificity

  • Comprehensive cross-reactivity testing against related proteins

Proper validation should include multiple techniques including Western blotting, immunoprecipitation, immunofluorescence, and flow cytometry to ensure antibody performance across different experimental contexts.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.