Recombinant Mouse Transmembrane protein 52 (Tmem52)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and agreed upon in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid forms have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Tmem52; Transmembrane protein 52
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
29-196
Protein Length
Full Length of Mature Protein
Species
Mus musculus (Mouse)
Target Names
Tmem52
Target Protein Sequence
DRNCDPSDQCPPQARWSSLWHVGLILLAILLMLLCGVTASCVRFCCLRKQTHTQSHTPAA WQPCDGTVIPVDSDSPAHSTVTSYSSVQYPLGMRLPLYFGEPDPDSMVPPTYSLYASELP PSYDEVVKMIKAREEVAAPSEKTNSLPEALEPETTGGPQEPGPSAQRP
Uniprot No.

Target Background

Database Links

KEGG: mmu:69671

UniGene: Mm.45401

Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is the official nomenclature and genomic location of mouse Tmem52?

Tmem52 is officially designated as "transmembrane protein 52" in mouse. Based on homology with human TMEM52, it is likely located on a syntenic chromosomal region to human 1p36.33 . The protein is characterized as a transmembrane protein with conserved domains across mammalian species. When documenting this protein in research publications, it is important to use the full official nomenclature "transmembrane protein 52" at first mention, after which the abbreviated form "Tmem52" is acceptable for subsequent references. Note that there are related family members, including TMEM52B, which should not be confused with TMEM52 despite their nomenclature similarity .

What expression systems are most effective for producing recombinant mouse Tmem52?

The selection of an expression system should be guided by downstream applications:

  • E. coli: Suitable for high-yield production of protein for antibody generation or structural studies not dependent on glycosylation

  • HEK293: Preferable for functional studies where proper protein folding and post-translational modifications are critical

  • Mammalian cells (general): Recommended when studying protein-protein interactions that may depend on mammalian-specific chaperones or folding machinery

What protein tags are compatible with recombinant mouse Tmem52 expression and their functional implications?

Multiple protein tags have been successfully utilized with recombinant mouse Tmem52, each conferring specific advantages for purification or detection:

Tag TypeExpression SystemFunctional ImplicationsApplications
HisE. coli, Mammalian cellsMinimal interference with protein structure, metal affinity purificationProtein purification, antibody screening
DDK & MycHEK293Dual-tag system allows for verification of full-length expressionCo-immunoprecipitation, protein localization studies
Avi & Fc & HisHEK293Triple-tag system enables versatile purification options and detection methodsComplex protein interaction studies, enhanced sensitivity detection
Magnetic Bead-coupledHEK293Pre-coupled to beads for direct use in pull-down assaysProtein-protein interaction screening

When selecting a tag, researchers should consider potential interference with transmembrane domain folding or function. C-terminal tags are generally preferred for transmembrane proteins to avoid disrupting signal peptide processing.

How do chemical exposures influence Tmem52 expression and what are the implications for experimental design?

Tmem52 expression is responsive to diverse chemical exposures, which has significant implications for experimental design and data interpretation. Based on gene-chemical interaction data from rat models (which can be extrapolated to mouse with appropriate caution), several compounds have been shown to modulate Tmem52 expression:

Chemical AgentEffect on Tmem52Experimental Consideration
1,2-dimethylhydrazineDecreases expressionPotential confounder in carcinogenesis studies
2,3,7,8-tetrachlorodibenzodioxineDecreases expressionConsider when studying environmental toxicants
17beta-estradiol with TGFB1Decreases expressionImportant for hormone-related research designs
4-hydroxyphenyl retinamideIncreases expressionPotential therapeutic modulator
Actinomycin DIncreases expressionConsider when using as transcription inhibitor
Alpha-ZearalanolDecreases expressionRelevant for endocrine disruptor studies

These interactions highlight the importance of carefully controlling exposure to these compounds in experimental settings. When designing experiments to study Tmem52 function, researchers should:

  • Include appropriate vehicle controls for all chemical exposures

  • Consider potential time-dependent effects, as expression changes may vary across different exposure durations

  • Validate expression changes through multiple methodologies (qPCR, western blot, etc.)

  • Consider the possibility of indirect regulatory effects through other pathways

What experimental approaches are most effective for studying Tmem52 protein-protein interactions?

Based on methodologies successfully employed for related transmembrane proteins, several approaches can be adapted for studying Tmem52 protein-protein interactions:

  • Immunoprecipitation coupled with mass spectrometry: This approach allows for unbiased identification of protein binding partners. The protocol should include:

    • Cell lysis in weak RIPA buffer (1% NP-40 and 0.25% deoxycholate) supplemented with protease inhibitors

    • Incubation with anti-tag magnetic beads (e.g., Anti-FLAG M2) at 4°C overnight

    • Washing followed by protein elution through boiling in SDS sample buffer

    • SDS-PAGE separation and subsequent mass spectrometry analysis of specific bands

  • In vivo ubiquitination assays: Particularly useful for studying protein degradation pathways:

    • Co-expression of HA-tagged ubiquitin, Flag-tagged protein of interest, and Tmem52

    • Cell lysis with IP buffer containing 0.5% SDS

    • Pre-denaturation at 95°C for 10 minutes followed by ultrasonic disintegration

    • Centrifugation and concentration of supernatant using Flag M2 beads

    • Western blot detection of associated proteins

  • Bioluminescence resonance energy transfer (BRET): Useful for monitoring protein interactions in living cells:

    • Fusion of Tmem52 with a luminescent donor protein (e.g., Renilla luciferase)

    • Fusion of potential interacting protein with an acceptor fluorophore

    • Measurement of energy transfer as indicator of protein proximity

What methodological considerations are critical for Tmem52 subcellular localization studies?

Studying subcellular localization of transmembrane proteins requires specific methodological considerations:

  • GFP fusion constructs:

    • Consider the position of the GFP tag relative to transmembrane domains

    • C-terminal tagging is generally preferable to avoid disrupting signal peptide processing

    • Validation with alternative tags (e.g., FLAG, Myc) is recommended to rule out tag-specific artifacts

  • Membrane fraction isolation:

    • Differential centrifugation protocols must be optimized for transmembrane protein recovery

    • Gentle detergent conditions (0.5-1% NP-40 or Triton X-100) help preserve membrane protein complexes

    • Control for potential contamination between subcellular fractions

  • Immunofluorescence microscopy:

    • Fixation protocols should be optimized (4% paraformaldehyde is generally suitable)

    • Membrane permeabilization conditions must balance antibody accessibility with preservation of membrane structures

    • Co-localization with established compartment markers is essential for accurate interpretation

These approaches have been successfully used for related transmembrane proteins, as demonstrated in studies of TMEM52B isoforms showing differential localization between cytoplasm and plasma membrane .

What are the optimal transfection protocols for studying Tmem52 in vitro?

Based on experimental protocols successfully used for related transmembrane proteins, the following transfection approaches can be adapted for Tmem52 studies:

  • Lipid-based transfection:

    • For siRNA transfection: Lipofectamine RNAiMAX has proven effective for TMEM52B knockdown in cancer cell lines

    • For plasmid DNA: Lipofectamine 3000 shows good efficiency for transmembrane protein expression

    • Optimization of DNA:lipid ratios is critical (typically start with manufacturer recommendations and adjust based on cell type)

  • Lentiviral transduction for stable expression:

    • Effective for generating stable Tmem52-expressing or Tmem52-knockdown cell lines

    • Protocol includes:

      • 10-hour incubation with lentiviral vectors in the presence of polybrene (5 μg/mL)

      • Selection with puromycin (1 μg/mL) for approximately one week

      • Validation of expression levels by qPCR and western blotting

  • Design considerations for expression constructs:

    • Full-length constructs (including signal peptide) are essential for proper membrane localization

    • For mouse Tmem52, constructs covering amino acids 29-196 represent the mature protein sequence

    • Inclusion of epitope tags should be strategically placed to avoid interference with transmembrane domains

What approaches can effectively generate and validate Tmem52 knockdown models?

Several RNA interference approaches have been successfully employed for transmembrane proteins and can be adapted for Tmem52:

  • siRNA-mediated transient knockdown:

    • Design multiple siRNA sequences targeting different regions of Tmem52 mRNA

    • Recommended target regions include:

      • Coding sequences unique to Tmem52 (not conserved in family members)

      • Regions with 40-60% GC content for optimal knockdown efficiency

    • Validation of knockdown efficiency at both mRNA level (qPCR) and protein level (western blot)

  • shRNA-mediated stable knockdown:

    • Construction of shRNA vectors based on validated siRNA sequences

    • Lentiviral delivery followed by antibiotic selection

    • Regular validation of continued knockdown efficiency over multiple passages

    • Consideration of potential off-target effects through rescue experiments

  • CRISPR-Cas9 genome editing:

    • Design of guide RNAs targeting early exons or critical functional domains

    • Verification of editing through sequencing and functional assays

    • Generation of clonal cell lines through single-cell isolation and expansion

    • Comprehensive validation through transcriptomic and proteomic approaches

What assays are most informative for evaluating Tmem52 function in cellular models?

To evaluate Tmem52 function comprehensively, multiple complementary assays should be employed:

  • Proliferation assays:

    • Cell Counting Kit-8 (CCK-8) assay for cell viability assessment

    • 5-ethynyl-2'-deoxyuridine (EdU) incorporation for direct measurement of DNA synthesis

    • Colony formation assays for long-term proliferative capacity

  • Migration and invasion assays:

    • Transwell migration assays (without Matrigel coating)

    • Invasion assays using Matrigel-coated transwell chambers

    • Wound healing/scratch assays for directional migration assessment

  • Protein interaction studies:

    • Co-immunoprecipitation for detecting direct protein binding partners

    • Proximity ligation assays for in situ visualization of protein interactions

    • Mass spectrometry-based interactome analysis for comprehensive binding partner identification

  • In vivo functional evaluation:

    • Xenograft models in immunocompromised mice

    • Analysis of tumor volume, weight, and histopathological features

    • Immunohistochemical assessment of protein expression in tissue sections

How should researchers interpret the molecular function of Tmem52 based on current evidence?

Interpretation of Tmem52 molecular function requires integration of multiple data sources:

What considerations are important when analyzing isoform-specific functions of Tmem52?

Based on findings from related transmembrane proteins like TMEM52B, which exhibits isoform-specific functions (P18 vs. P20), researchers should consider similar potential in Tmem52:

  • Isoform identification and validation:

    • Conduct RT-PCR with isoform-specific primers

    • Perform western blotting to confirm protein expression of different isoforms

    • Sequence verification of cloned isoforms before functional studies

  • Subcellular localization analysis:

    • Different isoforms may localize to distinct subcellular compartments

    • GFP fusion constructs can help visualize isoform-specific localization

    • Membrane vs. cytoplasmic distribution may correlate with functional differences

  • Isoform-specific manipulation strategies:

    • Design siRNAs targeting unique regions of specific isoforms

    • Create expression constructs for individual isoforms

    • Employ domain mutation studies to identify functional regions

  • Functional readout selection:

    • Different isoforms may affect distinct cellular processes

    • Comprehensive phenotypic analysis is recommended (proliferation, migration, signaling)

    • Interactome analysis may reveal isoform-specific binding partners

What emerging technologies could advance Tmem52 research?

Several cutting-edge technologies hold promise for deepening our understanding of Tmem52:

  • Cryo-electron microscopy:

    • Structural determination of Tmem52 in native membrane environments

    • Visualization of conformational changes upon ligand binding or protein interactions

    • Resolution of potential oligomeric structures

  • Single-cell multi-omics:

    • Correlation of Tmem52 expression with transcriptomic and proteomic profiles at single-cell resolution

    • Identification of cell populations with unique Tmem52 functional states

    • Mapping of Tmem52-dependent cellular trajectories during development or disease progression

  • Proximity labeling proteomics:

    • BioID or APEX2 fusion proteins for in situ labeling of Tmem52 interacting partners

    • Temporal mapping of dynamic Tmem52 protein complexes

    • Identification of transient or weak interactions missed by traditional co-immunoprecipitation

How might Tmem52 research contribute to understanding disease mechanisms?

Based on known roles of related transmembrane proteins and chemical interaction data, Tmem52 research may contribute to understanding several disease contexts:

  • Cancer biology:

    • Related family member TMEM52B functions as a tumor suppressor in colon cancer

    • Potential role of Tmem52 in proliferation, migration, and invasion pathways

    • Possible involvement in epithelial-mesenchymal transition via E-cadherin regulation

  • Response to environmental toxicants:

    • Modulation of Tmem52 expression by toxicants like tetrachlorodibenzodioxine suggests potential roles in toxicant response pathways

    • Possible biomarker for environmental exposure

    • Potential mediator of cellular response to chemical stress

  • Hormone-responsive processes:

    • Regulation by estradiol suggests potential roles in hormone-sensitive tissues

    • Possible involvement in endocrine disruption mechanisms

    • Contribution to sex-specific biological differences

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.