Recombinant Mouse Transmembrane protein 55A (Tmem55a)

Shipped with Ice Packs
In Stock

Description

Introduction

Transmembrane protein 55A (TMEM55A), also known as PIP4P2, is a lipid phosphatase that catalyzes the hydrolysis of phosphatidylinositol-4,5-bisphosphate (PIP2) to phosphatidylinositol-5-phosphate (PI5P) . TMEM55A is expressed throughout the body, including in the pancreas . It participates in the regulation of autophagy and α-cell exocytosis .

TMEM55A and α-Cell Function

Type 1 and type 2 diabetes are associated with disrupted glucagon secretion from islet α-cells . TMEM55A is correlated with α-cell function, and it regulates α-cell exocytosis by increasing intracellular PI5P levels to promote F-actin depolymerization via inhibition of the small G-protein RhoA . Oxidative stress acts upstream of the TMEM55A/PI5P/F-actin axis, resulting in increased glucagon exocytosis and glucagon hypersecretion .

TMEM55A is activated in response to oxidative stress to dephosphorylate PIP2 to PI5P, which inhibits the activation of RhoA . Inhibition of RhoA will depolymerize F-actin and promote glucagon exocytosis . This TMEM55A/PI5P/F-actin regulation axis is critical for glucagon secretion .

TMEM55A and Phagocytosis

TMEM55A negatively regulates the phagocytosis of large particles by reducing phagosomal PtdIns(4,5)P2 accumulation .

TMEM55A and Autophagy

TMEM55A is a positive regulator of autophagy .

Product Specs

Form
Lyophilized powder

Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.

Lead Time
Delivery times vary depending on the purchasing method and location. Please consult your local distributor for precise delivery estimates.

Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and agreed upon in advance. Additional fees apply for dry ice shipping.

Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.

The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.

Synonyms
Pip4p2; Tmem55a; Type 2 phosphatidylinositol 4,5-bisphosphate 4-phosphatase; Type 2 PtdIns-4,5-P2 4-Ptase; PtdIns-4,5-P2 4-Ptase II; Transmembrane protein 55A
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-257
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Target Protein Sequence
MAADGVDERSPLLSASHSGNVTPTAPPYLQESSPRAELPPPYTAIASPGTSGIPVINCRV CQSLINLDGKLHQHVVKCTVCNEATPIKTPPTGKKYVRCPCNCLLICKDTSRRIGCPRPN CRRIINLGPVMLISEEQPAQPALPIQPEGTRVVCGHCGNTFLWMELRFNTLAKCPHCKKI SSVGSALPRRRCCAYVTIGMICIFIAVGLTVGTQDFSRRFHATYVSWAIAYLLGLICLIR ACYWGAIRVSYPEHGFA
Uniprot No.

Target Background

Function

Recombinant Mouse Transmembrane protein 55A (Tmem55a) catalyzes the hydrolysis of phosphatidylinositol-4,5-bisphosphate (PtdIns-4,5-P2) to phosphatidylinositol-4-phosphate (PtdIns-4-P). It does not hydrolyze phosphatidylinositol 3,4,5-trisphosphate, phosphatidylinositol 3,4-bisphosphate, inositol 3,5-bisphosphate, inositol 3,4-bisphosphate, phosphatidylinositol 5-monophosphate, phosphatidylinositol 4-monophosphate, or phosphatidylinositol 3-monophosphate. Tmem55a negatively regulates the phagocytosis of large particles by reducing phagosomal phosphatidylinositol 4,5-bisphosphate accumulation during cup formation.

Database Links
Subcellular Location
Late endosome membrane; Multi-pass membrane protein. Lysosome membrane; Multi-pass membrane protein. Cell membrane; Multi-pass membrane protein. Cytoplasmic vesicle, phagosome membrane; Multi-pass membrane protein.

Q&A

What is Mouse Transmembrane protein 55A (Tmem55a) and what is its enzymatic function?

Tmem55a (also known as PIP4P2, AI315591, AV001360, 2610319K07Rik) is a type 2 phosphatidylinositol 4,5-bisphosphate 4-phosphatase with the EC number 3.1.3.78 . This transmembrane protein is primarily expressed in LE/lys membranes where it catalyzes the dephosphorylation at the D4 position of phosphatidylinositol 4,5-bisphosphate [PI(4,5)P2] . The enzymatic reaction results in the generation of PI5P, which serves as an important signaling lipid in the endolysosomal system. This phosphatase activity is critical for maintaining proper phosphoinositide composition in cellular membranes, which in turn regulates various membrane trafficking and signaling events. The catalytic function is mediated by a conserved CX5R motif in the phosphatase domain, which is characteristic of this class of enzymes and essential for substrate recognition and catalysis.

How does the structure of Tmem55a relate to its function?

Tmem55a possesses a domain architecture that directly supports its dual role as both an enzyme and a membrane-anchored protein. The protein contains a phosphatase domain with a catalytic CX5R motif that is responsible for its phosphoinositide 4-phosphatase activity . Additionally, Tmem55a features two putative transmembrane domains at its C-terminus that anchor it to the LE/lys membrane, positioning the catalytic domain to access its phosphoinositide substrates . This structural arrangement allows Tmem55a to function at the interface between membranes, particularly at membrane contact sites between the endoplasmic reticulum and lysosomes. The enzyme's structure also enables protein-protein interactions, notably with the tubular ER protein Tex2, which occurs via interaction between Tex2's N-terminal region and a catalytic motif in the phosphatase domain of Tmem55a . This structural relationship between the catalytic domain and transmembrane anchoring is essential for Tmem55a's role in regulating lysosomal functions, including trafficking, digestive capacity, and lipid composition.

What methods can be used to study Tmem55a-mediated membrane contact sites?

Investigating Tmem55a-mediated membrane contact sites requires a multifaceted approach combining imaging techniques, biochemical assays, and molecular manipulations. High-resolution live-cell microscopy is a powerful method for visualizing Tmem55a at membrane contact sites between the ER and LE/lys. This can be achieved by expressing fluorescently tagged Tmem55a (e.g., Halo-TMEM55A) along with markers for the ER (e.g., ER-tagRFP) and lysosomes (e.g., Lamp1-mCh) . Three-dimensional rendering of z-stacks through high-resolution live-cell microscopy can provide detailed spatial information about the localization of Tmem55a relative to other proteins and organelles . Correlative light electron microscopy (CLEM) offers another approach by combining the specificity of fluorescence microscopy with the ultrastructural detail of electron microscopy, enabling direct examination of Tmem55a-mediated recruitment of ER membranes to LE/lys . For studying protein-protein interactions at these sites, co-immunoprecipitation assays using GFP-Trap or similar approaches can identify interacting partners of Tmem55a, such as Tex2 . Additionally, mutational analysis through the creation of truncated or domain-deleted versions of Tmem55a can help map the specific regions responsible for protein interactions and membrane recruitment . These approaches collectively provide a comprehensive toolkit for dissecting the molecular mechanisms underpinning Tmem55a's role at membrane contact sites.

How can the phosphatase activity of recombinant Tmem55a be measured in vitro?

Measuring the phosphatase activity of recombinant Tmem55a requires specialized assays that account for its membrane-associated substrate preference and specific enzyme kinetics. A standard approach involves using purified recombinant Tmem55a (typically ≥85% purity as determined by SDS-PAGE) in an in vitro phosphatase assay with PI(4,5)P2 as the substrate. The reaction can be monitored by quantifying either the release of inorganic phosphate or the production of PI5P. For phosphate release detection, the malachite green assay provides a colorimetric method that measures free phosphate released from the substrate. Alternatively, radiometric assays using [32P]-labeled PI(4,5)P2 enable sensitive detection of phosphate removal. To measure PI5P production, thin-layer chromatography (TLC) or high-performance liquid chromatography (HPLC) can be employed to separate and quantify the lipid products. Given Tmem55a's association with membranes, incorporating its substrate into liposomes or supported lipid bilayers can create a more physiologically relevant reaction environment. Additionally, researchers should consider including appropriate controls, such as phosphatase-dead mutants (typically mutations in the CX5R motif), to confirm the specificity of the observed activity. The assay conditions should be optimized for pH, divalent cation concentrations, and detergent presence, as these factors can significantly impact enzyme activity.

What approaches can be used to study Tmem55a-Tex2 interactions?

The interaction between Tmem55a and Tex2 represents an important aspect of membrane contact site formation and function. Several complementary approaches can be employed to characterize this interaction in depth. Fluorescence microscopy using tagged proteins provides a powerful tool for examining the co-localization and recruitment dynamics in live cells. By expressing fluorescently labeled Tmem55a (e.g., Halo-TMEM55A) and Tex2 (e.g., GFP-Tex2), researchers can observe their co-localization at ER-lysosome contact sites . Biochemical approaches such as co-immunoprecipitation (co-IP) assays can confirm direct protein-protein interactions, as demonstrated by the successful co-IP of GFP-Tex2-NT with Halo-TMEM55B . Domain mapping through the creation of truncation or deletion mutants helps identify the specific regions required for interaction. Studies have shown that the N-terminal region of Tex2 (residues 1-517) is sufficient for recruitment by TMEM55, while deletion of residues 1-276 substantially reduces this interaction . Structure-function analysis through site-directed mutagenesis, particularly targeting the CX5R motif in the phosphatase domain of Tmem55a, can further elucidate the molecular determinants of this interaction. Additionally, proximity labeling techniques such as BioID or APEX can identify proteins in close proximity to Tmem55a in their native cellular environment, potentially revealing additional components of these contact sites.

How does Tmem55a contribute to endosome-lysosome dynamics?

Tmem55a plays a multifaceted role in endosome-lysosome dynamics through its enzymatic activity and protein-protein interactions. As a phosphoinositide 4-phosphatase, Tmem55a dephosphorylates PI(4,5)P2 at the D4 position to generate PI5P on LE/lys membranes . This modification of the phosphoinositide profile directly influences membrane properties and the recruitment of effector proteins that recognize specific phosphoinositides. Research indicates that Tmem55a contributes to lysosomal functions through its interaction with the tubular ER protein Tex2 at membrane contact sites between the ER and LE/lys . These contact sites serve as platforms for the exchange of lipids, ions, and other molecules between the two organelles. Knockout studies of Tex2, a Tmem55a-interacting partner, have revealed defects in lysosomal trafficking, digestive capacity, and lipid composition of LE/lys membranes . This suggests that the Tmem55a-Tex2 interaction at these contact sites is critical for maintaining proper lysosomal function. The regulation of this interaction by endosome-resident type 2 PI4K activities further highlights the dynamic control of these processes . Together, these findings point to Tmem55a as a key regulator of endosome-lysosome dynamics through both its enzymatic modulation of membrane lipid composition and its role in establishing functional membrane contact sites.

How is the enzymatic activity of Tmem55a regulated in different cellular contexts?

The regulation of Tmem55a enzymatic activity likely occurs through multiple mechanisms that integrate various cellular signals and conditions. As a phosphoinositide 4-phosphatase containing a CX5R motif in its phosphatase domain , Tmem55a's activity may be modulated through conformational changes induced by binding partners or post-translational modifications. The interaction between Tmem55a and Tex2 occurs between a catalytic motif in the phosphatase domain of Tmem55a and the N-terminal region of Tex2 , suggesting that protein-protein interactions might directly influence the enzyme's catalytic capacity. Furthermore, this interaction is regulated by endosome-resident type 2 PI4K activities , indicating a complex regulatory network involving other lipid-modifying enzymes. The local lipid environment within the membrane likely plays a significant role in regulating Tmem55a activity, as alterations in membrane composition can affect enzyme accessibility to its substrate. Cellular stressors, such as nutrient deprivation or oxidative stress, might trigger signaling pathways that modulate Tmem55a function, potentially as part of adaptive responses. Additionally, the acidic environment of lysosomes could influence the enzyme's conformation and activity. Differential expression or localization of Tmem55a under varying cellular conditions represents another layer of regulation, potentially allowing cells to fine-tune phosphoinositide metabolism in response to changing needs or environmental challenges.

What are common challenges in obtaining active recombinant Tmem55a?

Producing active recombinant Tmem55a presents several technical challenges due to its nature as a transmembrane phosphatase. One significant challenge is maintaining proper protein folding and stability, particularly of the catalytic phosphatase domain containing the critical CX5R motif . Expression systems must be carefully selected based on the specific experimental requirements; while prokaryotic systems like E. coli offer high yield, they may not provide the appropriate environment for correct folding of mammalian transmembrane proteins . The presence of two putative transmembrane domains at the C-terminus further complicates expression, as these hydrophobic regions can cause aggregation during expression and purification . Researchers often need to optimize detergent conditions during extraction and purification to maintain the protein in a native-like membrane environment. Another common issue is achieving sufficient purity while preserving activity. Standard purification processes aim for ≥85% purity as determined by SDS-PAGE , but aggressive purification steps may compromise enzymatic activity. The retention of post-translational modifications that might be essential for function presents another challenge, particularly when using non-mammalian expression systems. Additionally, proper reconstitution of the purified protein into appropriate lipid environments for activity assays requires careful optimization of lipid composition and protein-to-lipid ratios. Finally, the development of reliable activity assays can be difficult due to the membrane-associated nature of the enzyme's substrate, PI(4,5)P2, which may not be readily accessible in standard solution-based assays.

How can researchers distinguish between Tmem55a and Tmem55b activities in experimental settings?

Distinguishing between Tmem55a and Tmem55b activities presents a significant challenge due to their 51% amino acid sequence identity and similar enzymatic functions . Several strategies can be employed to address this challenge. Selective gene knockout or knockdown approaches using CRISPR/Cas9 or siRNA targeting unique regions of each isoform can help isolate the contribution of each protein. When using antibody-based detection methods, researchers should carefully validate antibody specificity, as cross-reactivity is a common issue with highly similar proteins. Commercial antibodies specifically targeting unique epitopes of either Tmem55a or Tmem55b should be thoroughly validated using knockout controls . For recombinant protein studies, using epitope-tagged versions (such as Halo-TMEM55A or Halo-TMEM55B) can facilitate specific detection and isolation . In activity assays, subtle differences in substrate preference, pH optimum, or sensitivity to inhibitors might exist between the two isoforms and could be exploited for discrimination. Mass spectrometry-based approaches offer another avenue, as they can distinguish between peptides unique to each isoform, enabling specific identification and quantification. Finally, examining tissue-specific or developmental expression patterns may reveal contexts where one isoform predominates, providing a natural system in which to study the function of a single isoform with minimal interference from the other.

What controls should be included in experiments studying Tmem55a-Tex2 interactions?

When investigating Tmem55a-Tex2 interactions, robust experimental design requires several key controls to ensure specificity and reliability of results. For co-localization studies using fluorescence microscopy, appropriate negative controls include the expression of fluorescently tagged Tmem55a along with non-interacting ER proteins (such as GFP-E-Syt1, which has been shown not to be recruited by TMEM55B) . Additionally, using untransfected cells as background controls helps establish baseline fluorescence levels. In biochemical interaction studies like co-immunoprecipitation, several controls are essential: input samples to verify protein expression, IgG or non-specific antibody controls to assess non-specific binding, and reciprocal co-IPs (pulling down with anti-Tex2 and probing for Tmem55a, and vice versa). Structure-function analyses should include systematic domain deletions or mutations in both proteins to map interaction interfaces comprehensively. For instance, testing Tex2 mutants such as Tex2-ΔSMP, Tex2-SMP alone, and Tex2-Δ1-276 provides valuable negative and positive controls for interaction studies . When investigating the functional consequences of this interaction, rescue experiments in knockout backgrounds provide strong evidence for specificity. This could involve expressing wild-type or mutant versions of either protein in cells lacking the endogenous protein and assessing the restoration of phenotypes. Finally, when studying the regulation of this interaction by PI4K activities or other factors, appropriate pharmacological controls, including solvent controls and dose-response relationships, should be included to support the specificity of the observed effects.

What are emerging areas of investigation for Tmem55a function?

The study of Tmem55a is evolving rapidly, with several exciting frontiers emerging at the intersection of membrane biology, cell signaling, and organelle communication. One promising area is the detailed characterization of membrane contact sites facilitated by Tmem55a and their role in inter-organelle communication and lipid transport. While Tmem55a has been shown to recruit Tex2 to ER-lysosome contact sites , the full complement of proteins present at these sites and their coordinated functions remain to be fully elucidated. The discovery that Tex2 knockout results in defects in lysosomal trafficking, digestive capacity, and lipid composition raises important questions about how Tmem55a might regulate these processes through additional mechanisms beyond Tex2 recruitment. The regulation of Tmem55a by endosome-resident type 2 PI4K activities points to a complex interplay of lipid-modifying enzymes that warrants further investigation. Advanced proteomics approaches could reveal novel Tmem55a-interacting partners that might influence its localization, activity, or downstream effectors. Single-molecule imaging techniques offer the potential to visualize the dynamics of Tmem55a recruitment and function in real-time, providing insights into the temporal aspects of its activity. Additionally, the investigation of Tmem55a in diverse physiological contexts, such as immune cell function, neuronal signaling, or metabolic regulation, could uncover tissue-specific roles beyond the currently established functions. Finally, comparative studies between Tmem55a and Tmem55b might reveal unique aspects of each isoform's biology that have evolved to serve specialized cellular needs.

What technologies are advancing our ability to study Tmem55a dynamics and interactions?

Cutting-edge technologies are transforming our capacity to investigate Tmem55a at unprecedented resolution in space and time. Super-resolution microscopy techniques such as STORM, PALM, and STED now enable visualization of Tmem55a localization and protein-protein interactions at nanometer-scale resolution, bypassing the diffraction limit of conventional light microscopy. These approaches can reveal the precise spatial organization of Tmem55a relative to other proteins at membrane contact sites. Live-cell imaging with improved temporal resolution allows researchers to track the dynamics of Tmem55a recruitment and dissociation in response to various cellular stimuli. Correlative light electron microscopy (CLEM), which has already been applied to study Tmem55-mediated recruitment of Tex2-positive ER membranes to LE/lys , continues to evolve with improved workflows and resolution. Proximity labeling methods like BioID, APEX, and TurboID enable the identification of proteins in close spatial proximity to Tmem55a in living cells, potentially revealing new interaction partners and functional associations. Cryo-electron tomography offers the possibility of visualizing Tmem55a in its native cellular environment at molecular resolution. For functional studies, optogenetic approaches permit temporal control over Tmem55a activity or localization, allowing precise manipulation of its function. CRISPR-based genome editing technologies facilitate the creation of endogenously tagged versions of Tmem55a, enabling studies at physiological expression levels. Finally, advanced computational modeling approaches can integrate structural, biochemical, and imaging data to predict Tmem55a behavior and generate testable hypotheses about its function and regulation in complex cellular environments.

How might Tmem55a dysfunction contribute to disease processes?

The essential role of Tmem55a in phosphoinositide metabolism and lysosomal function suggests that its dysfunction could contribute to various pathological conditions. Lysosomal disorders represent one category where Tmem55a alterations might play a role, given that Tex2 knockout (a Tmem55a-interacting protein) results in defects in lysosomal trafficking, digestive capacity, and lipid composition . These phenotypes are reminiscent of certain lysosomal storage disorders, suggesting that Tmem55a dysregulation could potentially contribute to similar conditions. Neurodegenerative diseases often involve disrupted lysosomal function and altered phosphoinositide metabolism, making Tmem55a a potential factor in conditions like Alzheimer's or Parkinson's disease. The role of Tmem55a in establishing membrane contact sites between the ER and lysosomes connects it to cellular processes that are increasingly recognized as important in neurodegeneration. Metabolic disorders might also be influenced by Tmem55a dysfunction, as proper lysosomal function is critical for nutrient sensing and metabolic homeostasis. Cancer progression involves altered membrane trafficking and signaling pathways, areas where Tmem55a function intersects. The enzyme's ability to modify phosphoinositide composition could influence signaling cascades relevant to cell proliferation and survival. Immunological disorders could be affected by Tmem55a alterations, as proper endolysosomal function is essential for immune cell activities including antigen processing and presentation. Future research should investigate Tmem55a expression, localization, and activity in disease models and patient samples to clarify its potential contributions to pathogenesis and identify possible therapeutic interventions targeting this pathway.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.