Recombinant Mouse Transmembrane protein 55B (Tmem55b)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Mouse Transmembrane Protein 55B (Tmem55b)

Transmembrane protein 55B (TMEM55B), also known as phosphatidylinositol-4,5-bisphosphate 4-phosphatase 1 (PIP4P1), is an endo-lysosomal membrane protein critical for the appropriate trafficking of endo-lysosomes . TMEM55B is involved in the retrograde trafficking of lysosomes across multiple cell types . Genetic manipulation of TMEM55B demonstrates that this gene regulates cellular cholesterol metabolism by modulating low-density lipoprotein receptor (LDLR) .

Role in Cholesterol Metabolism

TMEM55B regulates plasma cholesterol levels by affecting PI(4,5)P2-mediated LDLR lysosomal degradation . Knocking down TMEM55B increases ApoE-containing lipoproteins and elevates cholesterol levels in LDL fractions .

In Western diet-fed mice, Tmem55b knockdown reduced LDLR protein levels, which correlated with higher plasma PCSK9 levels . In Ldlr -/- mice, Tmem55b knockdown did not significantly alter plasma lipid levels or lipoprotein particle concentrations, indicating that TMEM55B regulates plasma lipids through LDLR .

TMEM55B knockdown significantly increased PI(4,5)P2 levels in the livers of treated mice and increased PI(4,5)P2-LAMP1 colocalization in HepG2 cells .

Involvement in Alzheimer's Disease

Dysfunction of the endosomal-lysosomal network is a notable feature of Alzheimer’s disease (AD) pathology . TMEM55B is crucial for the trafficking of endo-lysosomes, and its transcription is regulated by TFEB, a master regulator of autophagy and lysosomal function . Overexpression of TMEM55B in the hippocampus reduces the accumulation of endo-lysosomes in dystrophic neurites surrounding Aβ plaques .

While TMEM55B expression depends on TFEB, TMEM55B can inhibit TFEB nuclear translocation, suppressing the expression of lysosomal genes .

Interaction with Tex2

Tex2, a tubular ER protein, resides at TMEM55-dependent ER–LE/lys MCSs required for lysosomal functions . TMEM55B recruits Tex2 to ER–LE/Lys MCSs . Live-cell confocal microscopy showed that overexpression of Halo-TMEM55B greatly recruited GFP-Tex2 to another organelle clustered at perinuclear regions .

Role as a Molecular Sensor

TMEM55B functions as a molecular sensor that coordinates autophagosome degradation, lysosomal repair, and activation of stress responses .

Data Tables and Research Findings

FeatureEffect of TMEM55B Knockdown
Cholesterol MetabolismIncreases plasma cholesterol levels by affecting PI(4,5)P2-mediated LDLR lysosomal degradation .
LipoproteinsIncreases ApoE-containing lipoproteins .
LDLR Protein LevelsReduces LDLR protein levels in Western diet-fed mice .
PI(4,5)P2 LevelsIncreases PI(4,5)P2 levels in the livers of treated mice and increases PI(4,5)P2-LAMP1 colocalization in HepG2 cells .
Endo-lysosomal AccumulationReduces the accumulation of endo-lysosomes in dystrophic neurites surrounding Aβ plaques in the hippocampus .
FeatureEffect of TMEM55B Overexpression
Endo-lysosomal TraffickingMay mitigate Aβ plaque-associated lysosomal dysregulation, perhaps by promoting retrograde trafficking .
TFEB ActivityCan inhibit TFEB nuclear translocation, suppressing the expression of lysosomal genes .
Tex2 RecruitmentGreatly recruits GFP-Tex2 to another organelle that clustered at perinuclear regions .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference for your own preparations.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Pip4p1; Tmem55b; Type 1 phosphatidylinositol 4,5-bisphosphate 4-phosphatase; Type 1 PtdIns-4,5-P2 4-Ptase; PtdIns-4,5-P2 4-Ptase I; Transmembrane protein 55B
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-284
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Target Protein Sequence
MAADGERSPLLSEAGDGGAGGNGLAGPGGSATGPGGGLTPSAPPYGAGKHAPPQAFPPFP EGHPAVLPGEDPPPYSPLTSPDSGSAPMITCRVCQSPINVEGKMHQHVVKCGVCNEATPI KNAPPGKKYVRCPCNCLLICKVTSQRIACPRPYCKRIINLGPVHPGPLSPEPQPMGVRVI CGHCKNTFLWTEFTDRTLARCPHCRKVSSIGRRYPRKRCICCFLLGLLLAVTATGLAFGT WKHAQQYGGIYAAWAFVILLAVLCLGRALYWACMKVSHPVQNFS
Uniprot No.

Target Background

Function
Recombinant Mouse Transmembrane protein 55B (Tmem55b) catalyzes the hydrolysis of phosphatidylinositol-4,5-bisphosphate (PtdIns-4,5-P2) to phosphatidylinositol-4-phosphate (PtdIns-4-P). It does not hydrolyze phosphatidylinositol 3,4,5-trisphosphate, phosphatidylinositol 3,4-bisphosphate, inositol 3,5-bisphosphate, inositol 3,4-bisphosphate, phosphatidylinositol 5-monophosphate, phosphatidylinositol 4-monophosphate, or phosphatidylinositol 3-monophosphate. Tmem55b regulates lysosomal positioning by recruiting JIP4 to lysosomal membranes, thereby inducing retrograde transport of lysosomes along microtubules. It contributes to the assembly of the V-ATPase complex in lysosomal membrane lipid rafts and subsequent amino acid-dependent activation of mTORC1. Tmem55b may also play a role in regulating cellular cholesterol metabolism.
Database Links
Subcellular Location
Late endosome membrane; Multi-pass membrane protein. Lysosome membrane; Multi-pass membrane protein. Cell membrane; Multi-pass membrane protein. Cytoplasmic vesicle, phagosome membrane; Multi-pass membrane protein.

Q&A

What is the primary function of TMEM55B in cellular physiology?

TMEM55B is a lysosomal transmembrane protein that functions primarily as a phosphatidylinositol-(4,5)-bisphosphate (PI P2) phosphatase, catalyzing the conversion of PI(4,5)P2 to PI5P . It plays crucial roles in:

  • Lysosomal positioning: TMEM55B recruits the dynein adapter JIP4 to lysosomes, promoting dynein-dependent transport of lysosomes toward the microtubule minus-end . Depletion of TMEM55B results in dispersion of lysosomes toward the cell periphery.

  • Autophagy regulation: TMEM55B mediates NEDD4-dependent PLEKHM1 ubiquitination, causing PLEKHM1 proteasomal degradation and halting autophagosome/lysosome fusion .

  • Lysosomal repair: TMEM55B promotes recruitment of ESCRT machinery components to lysosomal membranes to stimulate repair mechanisms .

  • Cellular stress responses: Under oxidative stress conditions, TMEM55B sequesters the FLCN/FNIP complex to facilitate translocation of transcription factor TFE3 to the nucleus, enabling expression of stress response genes .

  • Lipid metabolism: TMEM55B regulates plasma cholesterol levels by affecting PI(4,5)P2-mediated LDLR lysosomal degradation .

How is TMEM55B expression regulated across different mouse tissues?

TMEM55B is expressed ubiquitously across mouse tissues, but with tissue-specific patterns:

  • Highest expression: TMEM55B shows particularly high expression in organs of the reproductive system, especially in the testis .

  • Cell-specific expression in testis: Within the testis, TMEM55B is most highly expressed in Sertoli cells .

  • Transcriptional regulation: TMEM55B expression is transcriptionally upregulated following activation of transcription factors TFEB and TFE3, which occurs during starvation or cholesterol-induced lysosomal stress .

  • Age-dependent expression: Studies have examined TMEM55B expression levels in testis during aging, suggesting potential developmental regulation .

What are the most effective approaches for knocking down or knocking out TMEM55B in experimental models?

Several effective approaches have been documented for manipulating TMEM55B expression:

  • Antisense oligonucleotides (ASOs):

    • Western diet-fed C57BL/6J mice injected with ASOs targeting Tmem55b showed approximately 70% reduction in hepatic transcript and protein levels .

    • Dosage: 25 mg/kg body weight/week

    • Duration: Studies have used treatment periods of 3-4 weeks for basic phenotyping and up to 29 weeks for long-term studies .

  • siRNA knockdown:

    • Effective in cell culture models including HepG2 cells

    • Typically shows significant knockdown within 48-72 hours

  • CRISPR-Cas9 knockout:

    • Whole-body Tmem55b knockout mice have been generated using Sox2-Cre and floxed Tmem55b mice

    • Tmem55b floxed mice with loxP sites flanking exons 1-6 are available commercially

  • Validation methods:

    • Western blot using specific antibodies

    • qPCR using TaqMan primers (mouse: Mm01319582_m1)

    • Functional assays measuring PI(4,5)P2 levels as a downstream effect of TMEM55B activity

What phenotypic changes should researchers expect in TMEM55B-deficient mouse models?

TMEM55B-deficient mice exhibit several reproducible phenotypes that researchers should monitor:

  • Testicular phenotypes:

    • Decreased testis size

    • Presence of giant multinucleated germ cells in seminiferous tubules

    • Altered lysosomal positioning and size in Sertoli cells

    • Mild subfertility in male mice due to immobile and morphologically abnormal spermatozoa

  • Metabolic phenotypes:

    • Accelerated development of metabolic dysfunction-associated steatotic liver disease (MASLD) when fed Western or GAN diets

    • Increased hepatic lipid accumulation (1.4-1.5 fold increase) observable by Oil Red O staining and direct lipid quantification

    • Enhanced progression of hepatic fibrosis (more pronounced after 29 weeks on GAN diet)

  • Hematological changes:

    • Mild inflammation detected in thorough blood analysis

    • Potential impairment of bone marrow functions

  • Age-dependent joint phenotypes:

    • Ossification of hind leg joints in older animals

  • Lysosomal alterations:

    • Increased size of LAMP1-positive vesicles

    • Dispersion of lysosomes toward cell periphery

    • Enhanced lipophagy but impaired mitophagy

How does TMEM55B regulate lysosomal positioning and what methodologies best capture this function?

TMEM55B regulates lysosomal positioning through interaction with the dynein motor complex:

Mechanism:

  • TMEM55B recruits the dynein adapter JIP4 to lysosomal membranes

  • This recruitment induces dynein-dependent transport of lysosomes toward the microtubule minus-end (perinuclear region)

  • TMEM55B's cytoplasmic domain (CD) is both necessary and sufficient for this function

Recommended methodologies:

  • Lysosomal distribution analysis:

    • Immunofluorescence staining of LAMP-1 followed by quantification using integrated intensity measurements

    • Cell segmentation approach: Segment cells by scaling the perimeter in 10% decrements and plot cumulative integrated LAMP-1 intensity relative to the whole cell

  • Live cell imaging:

    • Time-lapse microscopy of fluorescently labeled lysosomes in control vs. TMEM55B-depleted cells

    • Track lysosomal movement using particle tracking software

  • FRB-FKBP rapamycin-induced heterodimerization system:

    • This system can be used to localize TMEM55B CD to different intracellular compartments

    • Can demonstrate that TMEM55B CD is sufficient to drive retrograde trafficking of target membranes

  • Protein-protein interaction assays:

    • Co-immunoprecipitation to verify interaction between TMEM55B and JIP4

    • Additional potential interaction partners include GBF1 (GTPase-activating protein) and TBC1D9B (guanosine triphosphate exchange factor)

What approaches are most effective for studying TMEM55B's role in lipid metabolism and hepatic steatosis?

TMEM55B plays important roles in lipid metabolism, with implications for hepatic steatosis and metabolic disease:

Recommended study approaches:

  • Diet-induced models:

    • Western diet (high fat) for early lipid accumulation studies

    • GAN diet (40% kcal fat, 20% kcal fructose, 2% cholesterol) for MASH-inducing conditions

    • Treatment durations: 21 weeks for moderate phenotypes, 29 weeks for more pronounced fibrosis

  • Lipid quantification methods:

    • Hepatic lipid extraction using chloroform-methanol (2:1) following the Folch method

    • TAG measurement using commercial kits (e.g., L-Type TG M kit)

    • Histological assessment with Oil Red O and H&E staining

  • Lipoprotein characterization:

    • Fast protein liquid chromatography (FPLC) fractionation of plasma to analyze cholesterol and apolipoprotein content

    • Ion mobility analysis for high-sensitivity determination of lipoprotein particle concentrations

    • Consider dextran sulfate treatment to precipitate ApoB- and ApoE-containing particles for differential analysis

  • Lipophagy assessment:

    • Electron microscopy to visualize lipid droplets in lysosomes

    • Co-localization studies of lipid droplet markers with lysosomal proteins

    • Measurement of fatty acid release from lysosomes to mitochondria

  • Mechanistic studies:

    • PI(4,5)P2 level measurement in cellular and tissue samples

    • LDLR trafficking and degradation assessment using co-localization with lysosomal markers

    • Recycling endosome markers (e.g., RAB11) co-localization with LDLR

How should researchers approach studying TMEM55B's role in cellular stress responses, particularly oxidative stress?

TMEM55B functions as a molecular sensor that coordinates autophagosome degradation, lysosomal repair, and activation of stress responses under oxidative conditions:

Experimental approaches:

  • Induction of oxidative stress:

    • Sodium arsenite (NaAsO2) treatment - shown to induce TMEM55B phosphorylation and enhanced interaction with NEDD4L

    • H2O2 exposure

    • Other treatments that can be considered: LLOMe (lysosomal damaging agent), CCCP (mitochondrial uncoupling compound), tunicamycin or thapsigargin (ER stress inducers)

  • Protein interaction studies under stress conditions:

    • Immunoprecipitation of TMEM55B under denaturing conditions followed by immunoblotting for interacting partners

    • Proteomic analysis comparing wild-type TMEM55B vs. mutants (e.g., TMEM55B-P66A with mutated PPXY motif)

    • Analysis of TMEM55B ubiquitination using HA-tagged ubiquitin expression systems

  • Evaluation of stress response pathways:

    • TFE3 nuclear translocation assessment by immunofluorescence or nuclear fractionation

    • Analysis of FLCN/FNIP complex sequestration by TMEM55B

    • Expression analysis of stress response genes regulated by TFE3

  • Model organisms for in vivo studies:

    • Zebrafish embryos with knockout of tmem55 genes show increased susceptibility to oxidative stress

    • Challenge with arsenite toxicity results in early death of tmem55-KO animals

  • Lysosomal repair assessment:

    • Analysis of ESCRT machinery recruitment to lysosomes

    • Measurement of lysosomal integrity under stress conditions

    • Co-localization studies of TMEM55B with ESCRT components

What are the optimal conditions for expressing recombinant mouse TMEM55B in bacterial systems?

While the search results don't provide specific details for TMEM55B expression, we can apply general principles for recombinant membrane protein expression in E. coli from related research:

Recommended expression strategy:

  • Expression vector selection:

    • pET series vectors with T7 promoter for high expression

    • Consider using a vector with a fusion tag (His6, GST, or MBP) to aid in purification and potentially increase solubility

  • Expression optimization using factorial experimental design:

    • Use a fractional factorial design to systematically evaluate multiple variables simultaneously

    • Variables to test include: concentrations of yeast extract, tryptone, glucose, glycerol, kanamycin, and inducer; absorbance at induction moment; and temperature of expression after induction

  • Key parameters for membrane protein expression:

    • Induction at lower temperatures (16-25°C) to slow down protein synthesis and allow proper folding

    • Induction at higher cell densities (OD600 of 0.6-0.8)

    • Lower IPTG concentrations (0.1-0.5 mM) to prevent formation of inclusion bodies

    • Addition of membrane-stabilizing compounds (glycerol 5-10%)

    • Consider specialized E. coli strains designed for membrane protein expression (C41(DE3), C43(DE3))

  • Extraction and purification considerations:

    • Use mild detergents for solubilization (DDM, LDAO, or OG)

    • Include protease inhibitors during lysis and purification

    • Consider purification under native conditions to maintain protein structure and function

  • Functional validation:

    • Phosphatase activity assay using PI(4,5)P2 as substrate

    • Protein-protein interaction studies with known binding partners like JIP4

What are the most sensitive methods for detecting and quantifying TMEM55B in tissue samples and cell lysates?

Based on published research approaches, the following methods are recommended for detecting and quantifying TMEM55B:

  • Western blot analysis:

    • Sample preparation: Homogenize tissues in RIPA lysis buffer with Protease Inhibitor Cocktail

    • Centrifugation: 15 min at 16,000g at 4°C

    • Protein denaturation: 95°C for 5 min in Laemmli buffer

    • Gel percentage: 8% SDS-PAGE gels work well for TMEM55B detection

    • Look for bands at approximately 30-35 kDa

  • Quantitative PCR:

    • RNA extraction followed by cDNA synthesis

    • TaqMan primer for mouse TMEM55B: Mm01319582_m1 (Thermo Fisher Scientific)

    • Normalization to housekeeping genes like CLPTM (Hs00171300)

    • Perform assays in triplicate using 100ng cDNA

  • Immunofluorescence microscopy:

    • Fixation: 4% paraformaldehyde

    • Co-staining with lysosomal markers (LAMP1) to verify localization

    • Assessment of lysosomal positioning as an indirect measure of TMEM55B function

  • Flow cytometry:

    • Can be used to assess downstream effects like PI(4,5)P2 levels

    • Useful for high-throughput screening of cell populations

  • Mass spectrometry:

    • For proteomic analysis and identification of post-translational modifications

    • Particularly useful for detecting phosphorylation changes in TMEM55B that occur under stress conditions

How does TMEM55B function in the context of neurodegenerative diseases such as Alzheimer's?

While research on TMEM55B's role in Alzheimer's disease is still emerging, several findings provide insights for researchers:

  • Expression patterns in disease models:

    • Mice carrying the 5xFAD genotype (a model for Alzheimer's disease) display higher levels of TMEM55B compared to wild-type controls

    • This suggests potential involvement in disease pathology or compensatory mechanisms

  • Impact on disease pathology:

    • 5xFAD mice deficient in TMEM55B show no significant differences in amyloid plaque burden compared to 5xFAD controls

    • No obvious differences in morphological changes within the plaque region were observed

  • Combined genetic models:

    • Analysis of double deficiency of TMEM55B and TMEM106B in a wildtype background suggests multiple proteins mediate lysosomal transport

    • Loss of a single transport protein may not severely impact neuron survivability

    • Impairment of multiple retrograde transport pathways may increase neurodegeneration

  • Hypothesized mechanisms:

    • TMEM55B's role in lysosomal positioning could affect amyloid processing

    • As lysosomes are critical for protein degradation, TMEM55B dysfunction might contribute to protein accumulation

    • In neurodegenerative diseases with lysosomal accumulation phenotypes, more than one trafficking pathway is likely disturbed

  • Suggested research approaches:

    • Combined genetic models targeting multiple lysosomal trafficking pathways

    • Long-term aging studies of TMEM55B knockout mice

    • Investigation of TMEM55B's interaction with known Alzheimer's disease risk factors

How does TMEM55B interact with mTORC1 signaling, and what methods best capture this relationship?

TMEM55B contributes to lysosomal homeostasis and amino acid-induced mTORC1 activation through several mechanisms:

Key interactions and mechanisms:

  • TMEM55B interacts with proteins involved in mTORC1 activation including components of:

    • Vacuolar-type proton ATPase (V-ATPase) complex

    • Ragulator complex at the lysosomal membrane

  • TMEM55B depletion results in:

    • Attenuated amino acid-induced phosphorylation of mTORC1 substrates S6K and 4E-BP

    • Lysosomal stress as evidenced by TFEB translocation to the nucleus

    • Abrogated recruitment of the V1 domain subcomplex of V-ATPase to lipid rafts

Recommended experimental approaches:

  • Protein interaction studies:

    • Proteomics and immunofluorescence analyses to identify TMEM55B-interacting proteins

    • Co-immunoprecipitation to verify interactions with V-ATPase and Ragulator components

    • Proximity ligation assays to detect protein-protein interactions in situ

  • mTORC1 activation assessment:

    • Measure phosphorylation of mTORC1 substrates (S6K and 4E-BP) in control vs. TMEM55B-depleted cells

    • Monitor mTORC1 recruitment to lysosomes following amino acid stimulation

    • Analyze effects of TMEM55B depletion on amino acid sensing

  • Lysosomal stress evaluation:

    • Monitor TFEB localization as an indicator of lysosomal stress

    • Assess lysosomal function and pH in TMEM55B-depleted cells

  • Lipid raft analysis:

    • Isolation of lipid rafts and assessment of V-ATPase components

    • Evaluation of the role of TMEM55B in V-ATPase complex assembly in lipid rafts

  • Functional rescue experiments:

    • Re-express wild-type TMEM55B or mutant versions in depleted cells

    • Assess which domains are critical for interaction with mTORC1 components and subsequent activation

How should researchers approach studying the potential redundancy between TMEM55A and TMEM55B?

Research suggests potential redundancy or additive functions between TMEM55A and TMEM55B, warranting careful experimental design:

Recommended approaches:

  • Expression profiling:

    • Compare tissue-specific expression patterns of TMEM55A and TMEM55B

    • Analyze whether one paralog is upregulated when the other is depleted

    • Examine co-expression patterns across different cell types and conditions

  • Single and double knockout models:

    • Compare phenotypes of TMEM55A-KO, TMEM55B-KO, and double knockout models

    • Loss of TMEM55A and TMEM55B leads to increased size of LAMP1-positive vesicles in testis

    • Double deficiency studies in neuronal contexts reveal more severe phenotypes than single knockouts

  • Molecular function comparison:

    • Analyze whether both proteins exhibit PI(4,5)P2 phosphatase activity

    • Compare subcellular localization patterns

    • Identify shared vs. unique protein interaction partners

  • Rescue experiments:

    • Test whether overexpression of TMEM55A can rescue TMEM55B-deficient phenotypes and vice versa

    • Create chimeric proteins to identify which domains contribute to shared functions

  • Evolutionary analysis:

    • Compare conservation of TMEM55A and TMEM55B across species

    • Identify organisms with only one paralog and examine functional differences

  • Tissue-specific considerations:

    • Evidence suggests that TMEM55A and TMEM55B may have more redundant functions in vivo in mice than previously reported in cell culture systems

    • Focus on tissues where both proteins are expressed to better understand potential compensatory mechanisms

How can researchers reconcile contradictory findings regarding TMEM55B's effects on lipid metabolism?

The literature contains some apparently contradictory findings about TMEM55B's role in lipid metabolism that researchers should carefully consider:

Apparent contradictions and reconciliation approaches:

  • LDLR degradation vs. lipid accumulation:

    • One study reports that TMEM55B knockdown increases plasma non-HDL cholesterol by enhancing LDLR lysosomal degradation

    • Other research shows TMEM55B knockout accelerates MASLD and hepatic lipid accumulation

    • Reconciliation: These may reflect different aspects of lipid homeostasis - LDLR degradation affects cholesterol uptake, while lipophagy/mitophagy balance affects intracellular lipid processing

  • Different experimental systems:

    • Create a systematic comparison table of experimental conditions:

      StudyModel SystemDiet/TreatmentDurationKey FindingsPI(4,5)P2 Levels
      Study AC57BL/6J + ASOWestern diet3-4 weeks↑plasma cholesterol↑94% in liver
      Study BTmem55b KOGAN diet21-29 weeks↑hepatic steatosis/fibrosisNot reported
  • Dual mechanisms of action:

    • TMEM55B may regulate multiple aspects of lipid metabolism:

      • PI(4,5)P2-dependent regulation of receptor trafficking

      • Coordination of lipophagy and mitophagy

      • Effects on lysosomal positioning impacting lipid processing

    • Design experiments that specifically isolate each pathway

  • Developmental vs. acute effects:

    • Compare acute knockdown (ASO) vs. developmental knockout models

    • Consider compensatory mechanisms that may emerge in genetic models

  • Tissue-specific effects:

    • Perform tissue-specific knockout studies

    • Compare hepatic vs. systemic effects of TMEM55B modulation

What are common technical challenges when working with TMEM55B and how can they be addressed?

Based on the literature, researchers may encounter several technical challenges when studying TMEM55B:

  • Protein detection challenges:

    • Issue: TMEM55B can undergo post-translational modifications (phosphorylation) under stress conditions, causing shifts in electrophoretic mobility

    • Solution: Use phosphatase treatments of samples prior to SDS-PAGE, or employ Phos-tag gels for better resolution of phosphorylated species

  • Localization studies:

    • Issue: TMEM55B traffics through the plasma membrane before reaching the endo-lysosomal compartment

    • Solution: Use pulse-chase experiments or dynamin inhibition (GFP-Dynamin-K44A) to track trafficking pathways and distinguish mature lysosomal TMEM55B from newly synthesized protein

  • Functional domain analysis:

    • Issue: Identifying critical functional domains and motifs

    • Solution:

      • Use site-directed mutagenesis of key motifs (e.g., the PPXY motif at P66)

      • Employ the FRB-FKBP rapamycin-induced heterodimerization system to test specific domains

  • Redundancy with TMEM55A:

    • Issue: Potential functional compensation by TMEM55A

    • Solution: Generate double knockout/knockdown models or use region-specific approaches where TMEM55A is not expressed

  • PI(4,5)P2 measurement:

    • Issue: Accurately quantifying changes in PI(4,5)P2 levels

    • Solution: Combine multiple approaches including confocal microscopy, flow cytometry, and direct biochemical measurement of phospholipids

  • Lysosomal positioning quantification:

    • Issue: Objective measurement of lysosomal distribution

    • Solution: Use cell segmentation approaches that quantify the cumulative integrated intensity of lysosomal markers in defined regions from the cell center to the periphery

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.