Recombinant Mouse Transmembrane protein 56 (Tmem56)

Shipped with Ice Packs
In Stock

Description

Production and Purification

The recombinant protein is synthesized via heterologous expression in E. coli, followed by affinity chromatography using nickel-NTA resins . Key steps include:

  1. Cloning: The Tmem56 gene (UniProt ID: Q8CGF5) is inserted into plasmids under inducible promoters .

  2. Expression: Optimized using IPTG induction at 37°C .

  3. Purification: His-tag affinity chromatography ensures high yield (>1 mg/L culture) .

Erythropoiesis and Haem Metabolism

Studies using recombinant Tmem56-deficient murine models revealed:

  • Impaired erythroid progenitor cell differentiation in bone marrow .

  • Disrupted haem biosynthesis, leading to defective erythropoiesis under haemolytic stress .

  • Reduced survival of erythroid cells during anaemia (p < 0.01) .

Membrane Trafficking

The protein regulates vesicle formation and cargo transport, as shown by:

  • Interaction with lipid bilayers to facilitate ion exchange .

  • Role in maintaining cellular homeostasis via vesicle recycling pathways .

Applications in Experimental Assays

Recombinant Tmem56 is widely used as an antigen and functional reagent:

Table 2: Key Applications

ApplicationProtocol DetailsCitation
ImmunohistochemistryAntibody dilution: 1:20–1:200 (validated in murine tissues)
ELISALinear detection range: 0.1–1.0 µg/mL
Western BlotBand observed at ~31 kDa in erythroid cell lysates

Associated Research Tools

  • Antibodies: Polyclonal antibodies (e.g., CAC10390, orb26110) show high specificity for murine Tmem56 in IF and IHC .

  • siRNA/shRNA: Validated knockdown constructs (e.g., MISSION® esiRNA) reduce protein expression by >70% in vitro .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them when placing your order, and we will fulfill your request.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timeframes.
Note: All our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal results, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration between 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by factors such as storage conditions, buffer ingredients, temperature, and protein stability.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C. Lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type will be determined during the manufacturing process.
Tag type is determined during production. If you have a specific tag type in mind, please inform us, and we will prioritize developing it for your order.
Synonyms
Tlcd4; Tmem56; TLC domain-containing protein 4; Transmembrane protein 56
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-276
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Tmem56
Target Protein Sequence
MEASTKAAVGSGAMEASTKAVICTVCSSFVVFQILFHFVSYWFSARVSSGYNSLSIDKKI EWNSRVVSTCHSLLVGIFGLYLFFFDEATITDPLWGDPTYVNINIATASGYLISDLLIIL FNWKVIGDKFFIIHHCAGLTAYYFVLTTGALAYIANFRLLAELSSPFVNQRWFFEALKYP KFSKANVINGILMTVVFFIVRIISIPPMYFFLYSVYGTEPYIRFGFVIQSVWIVTCVILD VMNIMWMIKITKGCIKVISLIRQEKAKDSLQNGKLD
Uniprot No.

Target Background

Database Links
Protein Families
TMEM56 family
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is Tmem56 and what are its basic structural characteristics?

Tmem56 (Transmembrane Protein 56) is a multi-pass membrane protein found in mice and other mammals. Structurally, it contains multiple transmembrane domains that anchor it within cellular membranes. The human ortholog comprises 229 amino acids, and the mouse version shares high sequence homology with the human protein . While complete structural characterization of mouse Tmem56 is still emerging, predictive modeling suggests a topology similar to other transmembrane proteins in its family, with both cytoplasmic and extracellular domains connected by transmembrane helices.

Based on research with related transmembrane proteins, these structural elements likely play crucial roles in the protein's function, potentially facilitating transport of molecules across membranes or participating in cellular signaling cascades. Unlike some other transmembrane proteins that have been extensively characterized, such as TMEM163 which has been shown to efflux zinc , the specific molecular function of Tmem56 requires further elucidation through targeted research approaches.

In which tissues is mouse Tmem56 predominantly expressed?

Expression analysis of mouse Tmem56 has revealed a tissue-specific distribution pattern that provides important clues about its potential physiological roles. According to the NCBI gene database, mouse Tmem56 expression is highest in lymphoid tissues (thymus and spleen) and parts of the digestive system (colon and large intestine) . This expression profile suggests potential involvement in immune functions and intestinal physiology.

The distinct tissue distribution pattern of Tmem56 differs from some related transmembrane proteins, indicating specialized roles within these tissues. For instance, while human TMEM56 shows high expression in erythroid cells and plays a role in erythropoiesis and haem metabolism , the preferential expression of mouse Tmem56 in lymphoid tissues suggests possible involvement in immune system development or function. Researchers investigating Tmem56 should consider these tissue-specific expression patterns when designing experiments and interpreting results.

What are the common methods for producing recombinant mouse Tmem56?

Recombinant production of mouse Tmem56 typically follows established protocols for membrane proteins, with several expression systems available depending on research requirements. Common expression hosts include E. coli, yeast, baculovirus-infected insect cells, and mammalian cell lines . Each system offers distinct advantages for protein production, purification, and downstream applications.

For optimal expression, the Tmem56 gene is generally cloned into appropriate expression vectors containing affinity tags (commonly His-tag) to facilitate purification. When selecting an expression system, researchers should consider factors such as proper protein folding, post-translational modifications, and membrane integration requirements. Mammalian expression systems often provide the most native-like environment for correct folding and modification of mammalian transmembrane proteins, though at higher cost and lower yield than bacterial systems.

Purification typically involves membrane solubilization with detergents, followed by affinity chromatography. For instance, research with similar transmembrane proteins has shown that n-dodecyl-β-D-maltoside (DDM) can be an effective detergent for solubilization while maintaining protein structure and function . Careful optimization of solubilization and purification conditions is essential to preserve protein integrity and activity.

How does mouse Tmem56 function compare to its human ortholog TMEM56?

While both mouse Tmem56 and human TMEM56 share high sequence similarity (reported to be approximately 90% identity and 95% similarity for related transmembrane proteins) , their functional profiles may differ in important ways. Human TMEM56 has been characterized for its role in erythroid cell development, with research demonstrating its involvement in haem biosynthesis and cell cycle progression in erythroid cells . Deletion studies in human cells have shown that TMEM56 deficiency disrupts haem metabolism and impairs erythroid differentiation .

In contrast, mouse Tmem56's predominant expression in lymphoid tissues (thymus and spleen) and intestinal tissues suggests potentially divergent physiological roles. This expression pattern difference indicates that while core molecular functions may be conserved, the physiological context and downstream effects might vary between species. When designing translational studies, researchers should be cautious about extrapolating findings between mouse models and human applications without validation.

For comprehensive functional characterization, comparative studies using knockout models in both species can provide valuable insights into conserved and divergent functions. Additionally, proteomic analyses of interaction partners in different tissues could reveal species-specific signaling networks associated with Tmem56/TMEM56.

What is known about the role of Tmem56 in disease models and pathological conditions?

These findings suggest that Tmem56 may play critical roles in stress erythropoiesis and recovery from hemolytic conditions. Given its expression in lymphoid tissues, investigators should also consider potential roles in immune-related disorders or inflammatory conditions, particularly those affecting the digestive system where expression is also high .

Future research directions might include:

  • Generation of tissue-specific knockout models to evaluate phenotypes in high-expression tissues

  • Investigation of Tmem56 expression changes in murine disease models, particularly inflammatory conditions of the intestine

  • Evaluation of potential genetic associations between Tmem56 variants and disease susceptibility

What are the known or predicted protein-protein interactions of mouse Tmem56?

  • Membrane protein complexes: Tmem56 may participate in multi-protein complexes within membranes, potentially interacting with other transmembrane proteins or membrane-associated cytoskeletal components.

  • Signaling pathways: Given the involvement of human TMEM56 in cell cycle progression , mouse Tmem56 might interact with cell cycle regulators or signaling molecules, particularly in lymphoid tissues where it shows high expression.

  • Transport mechanisms: If Tmem56 functions in transport (similar to how TMEM163 functions in zinc efflux ), it may interact with transporters, channels, or proteins involved in vesicular trafficking.

Research approaches to identify interaction partners could include co-immunoprecipitation followed by mass spectrometry, yeast two-hybrid screening, or proximity labeling techniques optimized for membrane proteins. When designing such experiments, researchers should consider the challenges of maintaining membrane protein integrity during solubilization and the potential for context-dependent interactions that may vary by tissue type.

How can I optimize expression and purification of recombinant mouse Tmem56?

Optimizing expression and purification of recombinant mouse Tmem56 presents several challenges common to membrane proteins. Based on experiences with similar transmembrane proteins, the following methodological approach is recommended:

Expression System Selection:

Expression SystemAdvantagesLimitationsBest For
E. coliHigh yield, low cost, rapidLimited post-translational modifications, challenging for membrane proteinsInitial screening, mutational studies
YeastModerate yield, eukaryotic modificationsSome glycosylation differences from mammalsFunctional studies requiring basic modifications
Insect cellsGood yield, most mammalian modificationsHigher cost, longer timelineStructural studies, activity assays
Mammalian cellsMost native-like modificationsHighest cost, lowest yieldDefinitive functional studies, antibody generation

For Tmem56, mammalian expression systems often provide the best balance of proper folding and post-translational modifications, though at lower yields than other systems . HEK293 or CHO cells are commonly used for this purpose.

Optimization Strategies:

  • Vector design: Include an N-terminal signal sequence and C-terminal purification tag (typically His6 or FLAG) .

  • Detergent screening: Test multiple detergents for solubilization. n-Dodecyl-β-D-maltoside (DDM) has proven effective for similar proteins .

  • Buffer optimization: Screen buffer conditions (pH, salt concentration) to maximize stability during purification.

  • Purification approach: Implement a two-step purification strategy, typically using affinity chromatography followed by size exclusion chromatography.

For quality control, assess protein purity by SDS-PAGE (target >85% purity) , protein identity by Western blotting with anti-tag or anti-Tmem56 antibodies, and structural integrity by circular dichroism or thermal shift assays.

What are effective approaches for studying Tmem56 function in cellular contexts?

Investigating Tmem56 function in cellular contexts requires methodologies that address its membrane localization while providing meaningful functional readouts. Several complementary approaches are recommended:

Genetic Manipulation Strategies:

  • CRISPR/Cas9 knockout: Generate Tmem56-deficient cell lines to study loss-of-function phenotypes. This approach has been successful in identifying erythroid differentiation defects for human TMEM56 .

  • RNA interference: Use siRNA or shRNA for transient or stable knockdown to assess dose-dependent effects.

  • Overexpression systems: Create inducible overexpression models using tetracycline-responsive promoters to avoid potential toxicity from constitutive overexpression.

Functional Assays:

  • Subcellular localization: Determine precise membrane localization using fractionation followed by Western blotting or immunofluorescence microscopy with tagged constructs or specific antibodies.

  • Transport assays: If transport function is suspected, measure movement of potential substrates using fluorescent probes or radioactive tracers.

  • Cell cycle analysis: Given the role of human TMEM56 in cell cycle progression , assess effects of Tmem56 manipulation on cell proliferation, cell cycle distribution, and response to stress conditions.

  • Tissue-specific phenotypes: In lymphoid or intestinal cell models (reflecting high endogenous expression), evaluate effects on lineage-specific functions.

When designing these studies, include appropriate controls such as rescue experiments with wild-type Tmem56 to confirm specificity of observed phenotypes. Additionally, consider using cell types that naturally express Tmem56 at high levels to ensure physiological relevance.

How can I design effective experiments to identify Tmem56 genetic variants and their functional impact?

Investigating genetic variants of Tmem56 and their functional consequences requires a systematic approach combining bioinformatic analysis with experimental validation:

Variant Identification Strategy:

  • Database mining: Utilize resources like NCBI's dbSNP to identify known non-synonymous SNPs in the Tmem56 gene .

  • Prioritization: Focus on variants in functional domains based on predicted secondary structure from resources like NCBI and UniProt .

  • Conservation analysis: Prioritize variants in evolutionarily conserved regions, suggesting functional importance.

  • Structural impact prediction: Use tools like PolyPhen-2 or SIFT to predict functional effects of amino acid substitutions.

Experimental Validation Approaches:

  • Site-directed mutagenesis: Generate recombinant Tmem56 variants using PCR-based cloning methods .

  • Expression and localization: Assess effects on protein expression, stability, and subcellular localization.

  • Functional assays: Compare wild-type and variant proteins using relevant functional assays (e.g., transport activity, interaction studies).

  • Cell-based phenotypes: Evaluate effects on cellular phenotypes through rescue experiments in Tmem56-knockout backgrounds.

When selecting variants for study, consider focusing on:

  • Variants in predicted transmembrane domains that might affect membrane integration

  • Variants at potential phosphorylation sites (similar to the S61 phosphorylation site identified in related proteins)

  • Variants that alter charge distribution (e.g., S61R, E286K in similar proteins) that could disrupt protein-protein interactions

This comprehensive approach enables systematic characterization of natural genetic variation in Tmem56 and provides insights into structure-function relationships.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.