Recombinant Mouse Transmembrane protein 59-like (Tmem59l)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Mouse TMEM59L Protein

Recombinant Mouse TMEM59L is a type I transmembrane protein expressed in mammalian cell systems, typically tagged with histidine (His) for purification . It mirrors the endogenous protein's structure, which includes a single transmembrane domain and N-linked glycosylation sites . This protein is prioritized in studies exploring neuronal development, autophagy, and neurodegenerative diseases due to its brain-specific expression .

Expression and Localization

  • Tissue Specificity: Highly expressed in mouse brain regions (cerebral cortex, cerebellum, hippocampus) .

  • Cellular Distribution: Localizes to Golgi apparatus, endosomes, and cell membranes .

  • Developmental Regulation: Expression increases during neuronal maturation .

Cell TypeTMEM59L ExpressionTMEM59 (Homolog) Expression
NeuronsHighModerate
Astrocytes/MicrogliaUndetectableModerate

Autophagy and Apoptosis Regulation

  • Overexpression induces caspase-dependent apoptosis in neuronal cells .

  • Interacts with autophagy proteins ATG5 and ATG16L1, enhancing LC3B lipidation (a marker of autophagosome formation) .

Protein Trafficking and Processing

  • Inhibits amyloid precursor protein (APP) transport to the cell surface, increasing intracellular APP levels .

  • Upregulates Rab GDP dissociation inhibitors (GDI1/GDI2), which regulate vesicular trafficking .

Oxidative Stress Response

  • Silencing TMEM59L reduces hydrogen peroxide-induced neuronal death and caspase-3 activation .

Applications in Biomedical Research

  • Neurodegenerative Disease Models: Used to study APP processing defects linked to Alzheimer’s disease .

  • Cancer Research: Explored for roles in epithelial-mesenchymal transition (EMT) and apoptosis pathways in colorectal/breast cancers .

  • Autophagy Studies: Serves as a tool to dissect molecular mechanisms of LC3-associated phagocytosis .

Research Limitations and Future Directions

  • Unresolved Mechanisms: The exact pathways linking TMEM59L to GDIs or Wnt signaling remain unclear .

  • Therapeutic Potential: Preclinical studies are needed to validate its role in cancer progression or neuroprotection .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer components, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its inclusion.
Synonyms
Tmem59l; Bsmap; Transmembrane protein 59-like; Brain-specific membrane-anchored protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
22-337
Protein Length
Full Length of Mature Protein
Species
Mus musculus (Mouse)
Target Names
Tmem59l
Target Protein Sequence
RDPFAPQLGDTQRCQQRCRQHHPGSPPAQPEPEGPSESPNNKAILISACERGCRLFSICR FVAKSSRPNATETECEAACTEAYVKAAEQRACSEGCWGQIPEPETQLEQKDLALDPPRGR LSLRYLFSMLCSDLMSSAQGFLSSSWTYSLQTDNRKVVVFQTQPVAENFAFQGSHLQRVE VTWRRSHPKALELHMDPVGPLDKVRKAKPRVKTSKAKVESEDQQESDFLSCMSRRSGLPR WVLFCCLFLSILIMLWLSCCTLVTTPGQHLKFQPLTAEQHKGLLVESDWPLYPPLPPPAY EDSTPPYKLKLDLTTL
Uniprot No.

Target Background

Function

Function: Modulates O-glycosylation and complex N-glycosylation during Golgi maturation of Amyloid Precursor Protein (APP). Inhibits APP transport to the cell surface and subsequent shedding.

Database Links
Protein Families
TMEM59 family
Subcellular Location
Golgi apparatus membrane; Single-pass type I membrane protein.

Q&A

What is Transmembrane protein 59-like (Tmem59l) and where is it primarily expressed?

Transmembrane protein 59-like (Tmem59l), also known as brain-specific membrane-anchored protein (BSMAP), is a neuronal-specific transmembrane protein first discovered in 1999. Unlike its homolog TMEM59, which shows ubiquitous expression across tissues, Tmem59l expression is predominantly limited to neurons and increases during development . The protein contains a transmembrane domain and functions in cellular processes including autophagy regulation, protein glycosylation, and apoptotic signaling pathways .

What is the subcellular localization of Tmem59l and how does it relate to its function?

Tmem59l is primarily localized in the Golgi apparatus and endosomes. Immunostaining analyses have demonstrated that TMEM59L protein colocalizes with insulin and GM130 (a Golgi complex marker) in MIN6 cells . This subcellular localization is consistent with its function in regulating N- and O-glycosylation processes during Golgi maturation and its role in protein trafficking. The specific localization enables Tmem59l to regulate glycosylation modifications of proteins such as the amyloid precursor protein (APP) by inhibiting APP maturation, trafficking, and shedding .

What experimental approaches are recommended for manipulating Tmem59l expression in cellular models?

When studying Tmem59l function through genetic manipulation, lentiviral vector systems have proven effective for both overexpression and knockdown experiments. For knockdown studies, researchers have successfully used shRNA-expressing lentiviral vectors with puromycin selection (1.2 μg/ml) to create stable cell lines with reduced Tmem59l expression .

For overexpression studies, CAG promoter-driven Tmem59l cDNA constructs can be used, with an IRES-zeocin-resistance gene cassette as a selection marker (200 μg/ml zeocin for selection) . Additionally, when conducting rescue experiments, shRNA-resistant Tmem59l constructs containing silent mutations in the shRNA target site should be employed to confirm phenotype specificity .

The following approach is recommended for establishing stable cell lines:

  • Seed cells in a 12-well plate and culture overnight

  • Infect with appropriate lentiviral vectors

  • Select infected cells with the appropriate antibiotic (puromycin for knockdown, zeocin for overexpression)

  • Validate expression changes via western blot or qPCR before proceeding with functional assays

What functional assays are appropriate for studying Tmem59l in the context of glucose metabolism?

For investigating Tmem59l's role in glucose-stimulated insulin secretion (GSIS), established protocols using MIN6c4 cells (a mouse insulinoma cell line) have been effective . The following methodology is recommended:

  • Culture MIN6c4 cells with manipulated Tmem59l expression (knockdown, overexpression, or rescue)

  • Starve cells in low-glucose medium for 2 hours

  • Stimulate with high glucose (typically 25 mM) or KCl (30 mM) for defined time periods

  • Collect supernatants and measure insulin secretion via ELISA

  • Normalize secretion data to total cellular insulin content and/or total protein

This approach allows for quantitative assessment of how Tmem59l affects both basal and stimulated insulin secretion. Previous research has demonstrated that Tmem59l knockdown significantly decreases glucose- and KCl-stimulated insulin secretion from MIN6c4 cells, and this phenotype can be rescued by overexpression of shRNA-resistant Tmem59l .

How can researchers effectively study the role of Tmem59l in autophagy regulation?

To investigate Tmem59l's function in autophagy regulation, the following experimental approach is recommended:

  • Protein Interaction Analysis: Co-immunoprecipitation experiments to confirm Tmem59l interaction with autophagy-related proteins ATG5 and ATG16L1

  • Autophagy Flux Assessment: Monitor LC3-I to LC3-II conversion and p62 degradation via western blot in cells with manipulated Tmem59l expression

  • Fluorescence Microscopy: Use GFP-LC3 puncta formation assays to visualize autophagosome formation

  • Electron Microscopy: For direct visualization of autophagic structures

  • Functional Blockade: Use autophagy inhibitors (like bafilomycin A1) to determine if the effects of Tmem59l manipulation are autophagy-dependent

How does Tmem59l regulate cell survival and apoptosis in neuronal cells?

Tmem59l plays a significant role in regulating neuronal cell survival and apoptosis, particularly under oxidative stress conditions. Research demonstrates that:

  • Overexpression of Tmem59l induces intrinsic caspase-dependent apoptosis more dramatically than its homolog TMEM59

  • Downregulation of Tmem59l protects neurons from hydrogen peroxide-induced cell death and prevents caspase-3 activation

  • The apoptotic effect involves activation of the intrinsic apoptotic pathway, as evidenced by caspase activation patterns

The mechanistic pathway appears to involve:

  • Initiation of autophagy through interaction with ATG5 and ATG16L1

  • Potential dysregulation of protein glycosylation and trafficking

  • Activation of caspase-dependent cell death pathways

These findings suggest that Tmem59l functions as a stress-responsive protein in neurons, with its downregulation potentially serving as a neuroprotective strategy against oxidative damage .

What is the role of Tmem59l in insulin secretion and glucose homeostasis?

Tmem59l has been identified as an important regulator of glucose-stimulated insulin secretion (GSIS). Functional studies have revealed that:

  • Suppression of Tmem59l expression in MIN6c4 cells (a mouse insulinoma cell line) results in significantly decreased glucose- and KCl-stimulated insulin secretion

  • The effect appears to be specific, as overexpression of Tmem59l can rescue the secretory defect in knockdown cells

  • Tmem59l colocalizes with insulin and GM130 (a Golgi complex marker) in MIN6 cells, suggesting involvement in insulin processing or vesicle trafficking

These findings indicate that Tmem59l positively regulates insulin secretion, likely through its role in protein glycosylation, trafficking, or membrane fusion events essential for the insulin secretory pathway. The specific molecular mechanisms may involve Tmem59l's function in regulating Golgi processing and potentially autophagy, which can influence insulin granule formation and exocytosis .

How does Tmem59l influence protein glycosylation and processing in the Golgi apparatus?

Tmem59l regulates protein glycosylation processes within the Golgi apparatus, affecting post-translational modifications crucial for proper protein function. Specifically:

  • Tmem59l regulates both N- and O-glycosylation steps during Golgi maturation

  • It has been shown to influence the glycosylation modifications of the amyloid precursor protein (APP), inhibiting APP maturation, trafficking, and shedding

  • This glycosylation regulatory function appears to be shared with its homolog TMEM59, suggesting a conserved mechanism

The molecular process likely involves:

  • Direct interaction with glycosylation enzymes or substrates

  • Regulation of enzyme localization within Golgi compartments

  • Influencing protein retention time in various Golgi compartments during processing

This glycosylation regulatory function has significant implications for protein folding, stability, and functional activity, potentially explaining Tmem59l's diverse effects on cellular processes from autophagy to insulin secretion .

What is the prognostic value of Tmem59l in cancer research?

Recent comprehensive analyses have revealed significant prognostic value of Tmem59l across various cancer types. Key findings include:

  • Expression Patterns: Tmem59l shows differential expression across cancer types compared to normal tissues, with potential as a diagnostic biomarker

  • Survival Analysis: High Tmem59l expression correlates with poor clinical outcomes in multiple cancer types based on TCGA database analysis

  • Pathway Associations: Tmem59l expression is linked to cancer-associated pathways including apoptosis, cell cycle, DNA damage response, and epithelial-mesenchymal transition

Importantly, correlation analyses have demonstrated that Tmem59l expression is significantly associated with tumor immune microenvironment characteristics, suggesting potential roles in cancer immunoregulation .

How does Tmem59l influence tumor immune microenvironment and response to immunotherapy?

Tmem59l demonstrates significant associations with tumor immune microenvironment features that may influence cancer progression and treatment response:

  • Immune Cell Infiltration: Tmem59l expression negatively correlates with immune infiltration levels in multiple cancer types, particularly with CD8 T cells and activated CD4 T cells

  • Immunosuppressive Environment: High Tmem59l expression is associated with:

    • Negative correlation with MHC expression

    • Positive correlation with immunosuppressive cells

    • Negative correlation with effector cells

  • Immune Checkpoint Correlation: Tmem59l expression negatively correlates with multiple immune modulators, including PD-L1, IDO1, TIGIT, CTLA-4, and BTLA

  • Immunotherapy Response: In the IMvigor210 cohort, high Tmem59l expression correlated with poor clinical response to PD-L1 therapy

These findings suggest Tmem59l may contribute to an "immune-excluded" tumor microenvironment, potentially explaining the association between high Tmem59l expression and poor immunotherapy outcomes .

What molecular pathways connect Tmem59l to cancer progression and immune regulation?

Tmem59l influences multiple signaling pathways relevant to both cancer progression and immune regulation:

PathwayRelationship with Tmem59lPotential Implications
IL6-JAK-STAT3Regulatory associationInflammation, cancer cell proliferation
IL2-STAT5Regulatory associationT-cell proliferation and differentiation
TGF-β signalingPositive correlationImmunosuppression, EMT promotion
EMTRegulatory associationCancer invasion and metastasis
Cell cycleRegulatory associationCancer cell proliferation
ApoptosisRegulatory associationCell death resistance

The connection between Tmem59l and these pathways may explain its association with both cancer progression and immunosuppression. The TGF-β pathway connection is particularly notable as it supports the hypothesis that Tmem59l contributes to an immune-excluded tumor microenvironment characterized by higher stromal scores .

What are the potential therapeutic implications of targeting Tmem59l in disease contexts?

Based on current research, targeting Tmem59l presents several potential therapeutic applications:

  • Neuroprotection: Downregulation of Tmem59l protects neurons from oxidative stress and prevents caspase-3 activation, suggesting potential applications in neurodegenerative diseases or stroke

  • Cancer Immunotherapy: As high Tmem59l expression correlates with poor immunotherapy response, targeting Tmem59l might:

    • Enhance T cell infiltration into tumors

    • Improve response to immune checkpoint blockade therapies

    • Counteract the immunosuppressive microenvironment

  • Metabolic Disorders: Given Tmem59l's role in insulin secretion, targeting its function might offer therapeutic avenues for certain forms of diabetes or metabolic syndrome

  • Combination Therapies: The application of anti-Tmem59l antibodies after other therapeutic interventions might represent an effective strategy, particularly in cancer treatment contexts

While preliminary evidence supports these potential applications, further research is needed to validate Tmem59l as a therapeutic target and develop effective targeting strategies.

What are the critical knowledge gaps in understanding Tmem59l biology?

Despite growing research on Tmem59l, several critical knowledge gaps remain:

  • The precise molecular mechanisms through which Tmem59l regulates autophagy remain incompletely characterized, particularly regarding how it interacts with the broader autophagy machinery beyond ATG5 and ATG16L1

  • The structural determinants that differentiate Tmem59l function from its homolog TMEM59, especially regarding their differential effects on apoptosis

  • The upstream regulators of Tmem59l expression during development and in disease states

  • The full spectrum of proteins whose glycosylation is regulated by Tmem59l beyond APP

  • The potential role of Tmem59l in non-neuronal tissues under stress conditions or pathological states

Addressing these knowledge gaps would significantly advance our understanding of Tmem59l biology and its potential as a therapeutic target .

What emerging technologies could accelerate Tmem59l research?

Several cutting-edge technologies could drive significant advances in Tmem59l research:

  • CRISPR-Cas9 Gene Editing: For creating precise knockout and knock-in models to study Tmem59l function in various cell types and tissues

  • Single-Cell Transcriptomics: To map Tmem59l expression patterns with cellular resolution in complex tissues

  • Spatial Transcriptomics: To understand the spatial context of Tmem59l expression in tissues

  • Proteomics Approaches: To comprehensively identify Tmem59l-interacting proteins and substrates affected by its glycosylation regulatory function

  • Cryo-EM and Structural Biology: To determine the three-dimensional structure of Tmem59l and its complexes with interacting partners

  • High-Content Imaging: For detailed analysis of Tmem59l's effects on cellular processes like autophagy and protein trafficking

  • Patient-Derived Organoids: To study Tmem59l in more physiologically relevant disease models

These approaches would provide deeper insights into Tmem59l's molecular mechanisms and disease relevance .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.