Recombinant Mouse Transmembrane protein 65 (Tmem65)

Shipped with Ice Packs
In Stock

Description

Introduction

Transmembrane protein 65 (Tmem65) is a protein that, in mice, is essential for the structure and function of the intercalated disc (ICD), a unique membrane structure critical for normal heart function . Recent studies have also suggested that Tmem65 is localized within the inner mitochondrial membrane . Disrupting the function of Tmem65 can result in impaired ICD structure, abnormal cardiac electrophysiology, and cardiomyopathy .

Role in Cardiac Function

Tmem65 plays a critical role in cardiac function, particularly in the organization of the ICD . Studies using mouse models have demonstrated that reducing Tmem65 expression leads to several adverse effects:

  • Impaired Conduction: Tmem65 knockdown results in electrocardiogram changes, including prolonged PR intervals and QRS duration, indicative of impaired cardiac conduction . Optical mapping of isolated hearts confirms these conduction abnormalities .

  • Abnormal Electrophysiology: While there are no reductions in Na+ currents, cardiomyocytes with Tmem65 knockdown show reduced Ca2+ and K+ currents compared to control cells .

  • Cardiomyopathy and Heart Failure: Knockdown of Tmem65 in mice leads to eccentric hypertrophic cardiomyopathy within three weeks, progressing to dilated cardiomyopathy with severe cardiac fibrosis by seven weeks post-injection . Tmem65 KD mouse hearts ultimately developed dilated cardiomyopathy, severe fibrosis, and congestive heart failure .

  • Hemodynamic Depression: Echocardiographic measurements reveal depressed hemodynamics in Tmem65 knockdown hearts .

Table 1: Impact of Tmem65 Knockdown on Cardiac Hemodynamics

ParameterTmem65 KD MiceControl MiceP-value
Ejection Fraction (%)14.83 ± 3.9276.75 ± 3.05< 0.01
Fraction Shortening (%)5.33 ± 1.5039.10 ± 2.69< 0.01
Left Ventricle Wall ThicknessDecreased compared to controls< 0.01

Mitochondrial Function

Research indicates Tmem65's presence in the inner mitochondrial membrane . Studies involving siRNA-mediated knockdown of Tmem65 in dermal fibroblasts have shown that reduced expression can severely affect mitochondrial content and respiration rate, suggesting its vital role in mitochondrial function .

Implications in Gastric Cancer

Recent studies have identified a role for TMEM65 in promoting gastric tumorigenesis . TMEM65 mRNA expression level was positively correlated with DNA copy number gain (P < 0.001; R = 0.4757) . Overexpression of TMEM65 can lead to increased protein expression of cell cycle markers such as Cyclin-D1, CDK4, and PCNA, while reducing the expression of tumor suppressors P53 and P21 cip1 .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice is specifically requested in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to pellet the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during production. If a specific tag type is required, please inform us; we will prioritize its development.
Synonyms
Tmem65; Transmembrane protein 65
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-234
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Tmem65
Target Protein Sequence
MSRLLPLLGSRTARSLRPGPAAAPRLPSWCCCGRGLLALGVPGGPRLLGTHPKKEPMEAL NTAQGARDFIYSLHSTERSCLLKELHRFESIAIAQEKLEALPPTPGQLRYVFFHNAIPFV GFGFLDNAIMIVAGTQIELSIGIILGISTMAAAALGNLVSDLAGLGLAGYVEALASRLGL SIPDLTPKQVDMWQTRVSTHLGKAVGVTIGCILGMFPLIFFGGSEEDEKLETTN
Uniprot No.

Target Background

Function
TMEM65 plays a crucial role in cardiac development and function. It may regulate cardiac conduction and the function of the gap junction protein GJA1, contributing to GJA1 stability and localization within the cardiac intercalated disc, thereby modulating gap junction communication. Additionally, TMEM65 regulates mitochondrial respiration and mitochondrial DNA copy number maintenance.
Gene References Into Functions
  1. TMEM65 is an intercalated disc protein that interacts with and functionally regulates ventricular Cx43. PMID: 26403541
Database Links
Subcellular Location
Cell membrane; Multi-pass membrane protein. Mitochondrion inner membrane; Multi-pass membrane protein.
Tissue Specificity
Predominantly expressed in the ventricular tissue (at protein level).

Q&A

What is Transmembrane protein 65 (Tmem65) and what are its cellular localizations?

The protein consists of 240 amino acids with a calculated molecular weight of 26 kDa, though it is often observed at approximately 18 kDa in Western blot analyses . This discrepancy between predicted and observed molecular weight may result from post-translational modifications or proteolytic processing, which researchers should consider when designing experiments.

What experimental approaches are available for detecting Tmem65?

Several validated antibodies are commercially available for detecting Tmem65 in various experimental settings. Western blot remains the primary detection method, with antibodies showing reactivity in multiple cell lines including MCF-7, HEK-293, PC-3, SH-SY5Y, and HeLa cells, as well as in mouse and rat brain tissues .

For Western blot applications, recommended dilutions typically range from 1:5000 to 1:50000, though optimization for specific experimental conditions is advisable . The following cell lines and tissues have been validated for Tmem65 detection:

Validated Samples for Tmem65 Detection
MCF-7 cells
HEK-293 cells
Mouse brain tissue
PC-3 cells
SH-SY5Y cells
HeLa cells
Rat brain tissue

Immunofluorescence techniques have also been employed to study the subcellular localization of Tmem65, particularly in cardiac tissues where co-localization with gap junction proteins is of interest .

What are the known functions of Tmem65 based on current research?

Current research indicates that Tmem65 serves multiple critical functions in cellular physiology:

  • Mitochondrial Function: Tmem65 plays a significant role in regulating mitochondrial respiration and maintaining mitochondrial DNA copy number . Knockdown studies have demonstrated that depleting Tmem65 severely affects mitochondrial content and respiration rates .

  • Cardiac Intercalated Disk (ICD) Structure: Tmem65 is essential for maintaining proper cardiac ICD structure and function, as well as cardiac conduction velocity . Its association with sodium channel β1 subunit (SCN1B) is required for stabilizing the perinexus in the ICD.

  • Gap Junction Regulation: Tmem65 regulates the function of gap junction protein connexin-43 (Cx43) and contributes to its stability and proper localization to cardiac intercalated disks, thereby regulating gap junction communication . Without Tmem65, Cx43 degradation increases, leading to disruption of cardiac electrical signals .

  • Ion Channel Localization: Tmem65 appears to be involved in the localization of both connexin-43 (GJA1) and the cardiac sodium channel (SCN5A) to the intercalated disk .

What phenotypes result from Tmem65 deficiency in experimental models?

Tmem65 knockout models have revealed critical insights into its physiological importance. Whole-body Tmem65 knockout mice exhibit severe phenotypes including:

  • Developmental impacts: Growth retardation beginning around postnatal day 15, with progressive regression leading to death between postnatal days 11-30 (average lifespan of 21.7 ± 3.6 days) .

  • Neurological manifestations: Epilepsy episodes (particularly prior to death), weakness, hindlimb paralysis, and uncoordinated walking . MRI studies revealed lesions and microcephaly with particular volume loss in the cerebral cortex and midbrain, consistent with pathological loss of neurons .

  • Histopathological findings: Neuronal vacuolar degeneration with nuclear shrinkage and condensation in the cingulate cortex and brain stem, similar to observations in Leigh syndrome, another mitochondrial encephalomyopathy .

  • Tissue-specific effects: Muscle-specific Tmem65 knockout mice exhibited reduced metabolic efficiency with higher energy expenditure, significantly decreased voluntary exercise performance (less than 20% of control littermates), and loss of both fat and lean mass, indicating metabolic uncoupling .

These findings collectively support Tmem65's essential role in mitochondrial function and energy metabolism across multiple tissues, particularly in high-energy demand tissues like brain and skeletal muscle.

What is known about human Tmem65 mutations and associated pathologies?

A homozygous splice variant (c.472+1G>A) in the TMEM65 gene has been identified in a patient with severe mitochondrial encephalomyopathy . This mutation dramatically reduces TMEM65 protein levels, providing the first clinical evidence that TMEM65 dysfunction results in human disease .

The clinical presentation aligns with findings from animal models, featuring severe abnormalities of skeletal muscle and brain . Fibroblasts from this patient demonstrated impaired mitochondrial function, providing further evidence for TMEM65's role in mitochondrial physiology .

This case establishes TMEM65 as a disease-causing gene in mitochondrial disorders and suggests that screening for TMEM65 mutations may be warranted in patients with unexplained mitochondrial encephalomyopathy, particularly those with prominent skeletal muscle and brain involvement.

How does Tmem65 regulate cardiac function and gap junction communication?

Tmem65 plays a crucial role in cardiac function through multiple mechanisms:

  • Gap junction formation and stability: Biochemical and imaging analyses have demonstrated that Tmem65 regulates connexin-43 (Cx43) to form functional gap junctions . In the absence of Tmem65, Cx43 undergoes increased degradation, compromising intercellular communication .

  • Electrical signal propagation: Optical mapping and microelectrode recording experiments have shown that cardiac electrical signals are disrupted when Tmem65 is absent or reduced . This finding supports Tmem65's role in maintaining proper cardiac conduction.

  • Intercalated disk architecture: Tmem65 is essential for maintaining the structural integrity of cardiac intercalated disks, specialized cell-cell junctions unique to cardiac muscle that ensure mechanical and electrical coupling between cardiomyocytes .

  • Sodium channel localization: The association between Tmem65 and SCN1B is required for proper localization of the cardiac sodium channel SCN5A to the intercalated disk, further influencing cardiac conduction .

These multiple mechanisms highlight Tmem65's central role in cardiac physiology and suggest that cardiac dysfunction should be monitored in patients with TMEM65 mutations.

What are the methodological approaches for investigating Tmem65's dual localization and function?

Investigating Tmem65's reported dual localization (mitochondrial inner membrane and cardiac intercalated disks) requires sophisticated methodological approaches:

  • Subcellular fractionation: This technique has confirmed Tmem65's presence in isolated mitochondrial fractions, specifically in the inner mitochondrial membrane . Researchers should implement differential centrifugation protocols with subsequent analysis of membrane fractions by immunoblotting.

  • Co-immunoprecipitation studies: These experiments can identify Tmem65's protein interaction partners in different cellular compartments. Previous studies have revealed interactions with gap junction proteins (Cx43) and sodium channel components (SCN1B, SCN5A) .

  • Super-resolution microscopy: Beyond conventional immunofluorescence, techniques like STORM (Stochastic Optical Reconstruction Microscopy) or STED (Stimulated Emission Depletion) microscopy can more precisely locate Tmem65 within subcellular structures and evaluate co-localization with known markers.

  • Proximity labeling techniques: Methods such as BioID or APEX2 can identify proteins in close proximity to Tmem65 in living cells, potentially uncovering novel interaction partners and functional domains.

  • Tissue-specific knockout models: Comparing cardiac-specific versus global Tmem65 knockout phenotypes can help delineate tissue-specific functions and resolve apparent contradictions in localization data .

These complementary approaches can help resolve the current debate regarding Tmem65's predominant site of action and clarify whether it serves distinct functions in different cellular compartments.

What experimental designs best characterize Tmem65's role in mitochondrial function?

To comprehensively characterize Tmem65's role in mitochondrial function, researchers should consider the following experimental approaches:

  • Respiratory chain analysis: Oxygen consumption measurements in cells with modulated Tmem65 expression have shown that knockdown severely impairs respiration rates . Studies should include measurements of basal respiration, ATP production, maximal respiration, and spare respiratory capacity.

  • Mitochondrial DNA analysis: Evidence suggests Tmem65 plays a role in maintaining mitochondrial DNA copy number . qPCR assays targeting mitochondrial versus nuclear DNA can quantify this effect.

  • Mitochondrial membrane potential: Fluorescent dyes like TMRM or JC-1 can assess whether Tmem65 depletion affects the proton gradient across the inner mitochondrial membrane.

  • Mitochondrial morphology: Electron microscopy and confocal imaging of mitochondria-targeted fluorescent proteins can determine if Tmem65 loss affects mitochondrial structure and network dynamics.

  • Metabolic flux analysis: Measuring glycolytic versus oxidative metabolism can reveal metabolic adaptations to Tmem65 deficiency, particularly relevant given the observed metabolic uncoupling in muscle-specific knockout mice .

  • Proteomics of isolated mitochondria: This approach can identify changes in the mitochondrial proteome resulting from Tmem65 depletion, potentially revealing downstream effectors and compensatory mechanisms.

Combining these methodologies provides a comprehensive assessment of how Tmem65 contributes to mitochondrial function and energy metabolism.

How can researchers differentiate between direct and indirect effects of Tmem65 manipulation?

Differentiating between direct consequences of Tmem65 loss and secondary adaptive responses presents a significant challenge. Researchers should consider these experimental strategies:

  • Acute versus chronic depletion: Comparing acute knockdown (e.g., siRNA) with stable knockout models can help distinguish immediate effects from compensatory adaptations. The progressive nature of phenotypes in Tmem65 knockout mice suggests an accumulation of dysfunction over time .

  • Rescue experiments: Re-expression of wild-type Tmem65 in knockout models should reverse direct effects. Structure-function studies using truncated or mutated Tmem65 can identify critical domains.

  • Temporal control systems: Inducible knockout models using Cre-ERT2 or similar systems allow for temporal control of Tmem65 depletion, enabling the study of immediate versus long-term consequences.

  • Single-cell analyses: Techniques like single-cell RNA-seq can reveal cell-to-cell variability in responses to Tmem65 loss, potentially identifying particularly vulnerable cell populations.

  • In vivo versus in vitro comparisons: Some phenotypes observed in vivo, such as neurological symptoms, may not be readily apparent in cell culture systems. Comprehensive analysis requires both approaches.

  • Multi-omics integration: Combining transcriptomics, proteomics, and metabolomics data from Tmem65-deficient models can help construct regulatory networks and identify key nodes that mediate Tmem65's effects.

These strategies collectively enable researchers to build a more accurate model of Tmem65's core functions versus secondary adaptations to its absence.

What therapeutic opportunities might arise from Tmem65 research?

The clinical relevance of Tmem65 dysfunction suggests several potential therapeutic avenues:

  • Gene therapy approaches: For patients with TMEM65 mutations, targeted gene replacement could theoretically restore normal mitochondrial and cardiac function. The single patient reported with a homozygous splice variant represents a potential candidate for such therapy .

  • Mitochondrial enhancement strategies: Since Tmem65 deficiency impairs mitochondrial function, therapies that enhance mitochondrial biogenesis or function (e.g., AMPK activators, NAD+ precursors) might mitigate disease symptoms.

  • Gap junction modulators: For cardiac manifestations related to connexin-43 dysfunction, pharmacological stabilization of gap junctions might partially compensate for Tmem65 deficiency .

  • Metabolic interventions: The metabolic uncoupling observed in muscle-specific knockout mice suggests that dietary or pharmacological interventions targeting energy metabolism might provide benefit .

  • Anti-seizure therapies: Given the epilepsy phenotype in knockout mice, standard or novel anti-seizure medications might be beneficial for neurological manifestations .

Future research should evaluate these potential therapeutic approaches in animal models before considering clinical translation.

What technical challenges must be overcome to advance Tmem65 research?

Several technical challenges currently limit progress in Tmem65 research:

  • Resolving localization controversies: The apparently conflicting reports of Tmem65 localization (mitochondrial versus intercalated disk) need resolution through improved subcellular fractionation and imaging techniques .

  • Structural characterization: The three-dimensional structure of Tmem65 remains unknown, limiting structure-based functional predictions and drug design efforts.

  • Tissue-specific regulation: The mechanisms governing potential tissue-specific expression or function of Tmem65 remain unclear and require investigation.

  • Species differences: Potential differences between mouse and human Tmem65 function should be carefully evaluated when translating findings from animal models.

  • Patient identification: The rarity of identified TMEM65 mutations suggests possible underdiagnosis. Improved genetic screening methods and increased awareness may identify additional patients.

  • Functional assays: Development of high-throughput functional assays for Tmem65 activity would accelerate both basic research and therapeutic development.

Addressing these challenges will require collaborative efforts across disciplines including molecular biology, structural biology, genetics, and clinical medicine.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.