Recombinant Mouse Transmembrane protein 68 (Tmem68)

Shipped with Ice Packs
In Stock

Description

Introduction

Transmembrane protein 68 (TMEM68) is an evolutionarily conserved protein belonging to the glycerophospholipid acyltransferase family . Initially of unknown function, TMEM68 has been identified as an endoplasmic reticulum (ER)-anchored acyltransferase that influences glycerolipid metabolism and triacylglycerol (TG) storage in mammalian cells . TMEM68 is highly expressed in the brain, suggesting a role in brain glycerolipid metabolism .

Functional Analysis

TMEM68 functions as an acyltransferase, affecting lipogenic gene expression, glycerolipid metabolism, and TG storage in mammalian cells . Overexpression of TMEM68 promotes TG accumulation and lipid droplet (LD) formation in an active site-dependent manner . Quantitative lipidomic analysis has demonstrated that TMEM68 expression increases diacylglycerol (DG), free fatty acid (FFA), and TG levels .

Lipid ClassEffect of TMEM68 Overexpression
Triacylglycerol (TG)Increased significantly (10-fold)
Diacylglycerol (DG)Increased
Free Fatty Acid (FFA)Increased
AcylcarnitineDecreased

Enzymatic Activity and Mutational Studies

The impact of TMEM68 on TG levels is dependent on its enzymatic activity . A mutant TMEM68 (mtTMEM68) with H129A and D135N mutations does not increase TG levels, indicating that TMEM68 increases TG accumulation through its enzyme active sites .

Subcellular Localization

Live cell imaging has confirmed that TMEM68 is mainly localized at the endoplasmic reticulum (ER) . Expression of TMEM68 tagged with GFP displays a pattern resembling the ER . Cells expressing TMEM68 accumulate more lipid droplets compared to cells without TMEM68 expression .

Impact on Lipid Metabolism

Overexpression of TMEM68 significantly increases total TG levels . The levels of DG and FFA, which are precursors of TG biosynthesis, also increase upon TMEM68 overexpression . TMEM68 influences the levels of glycerophospholipids like phosphatidylcholine, phosphatidylethanolamine, and phosphatidylinositol, as well as sterol ester content .

Tissue Specificity

Among murine tissues, TMEM68 transcript expression is highest in the brain, suggesting a specialized role in brain glycerolipid metabolism .

Role in Disease

While TMEM68 is associated with lipid metabolism, another transmembrane protein, TMEM88, has been studied in the context of malignant tumors . TMEM88 is involved in cell proliferation, differentiation, apoptosis, and tumor progression, with abnormal changes observed in various cancers, including breast, ovarian, lung, and thyroid cancers . TMEM88 can regulate the Wnt signaling pathway, affecting tumor cell proliferation and metastasis .

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is finalized during production. If a specific tag type is required, please inform us for preferential development.
Synonyms
Tmem68; Transmembrane protein 68
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-329
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Tmem68
Target Protein Sequence
MIDNNQTCAAGQDSVPYVTCMIYVLEEWLGVEQLEDYLNFANHLLWVFTPLILLILPYFT IFLLYLTIIFLHIYKRKNVLKEAYSHNLWDGARKTVATLWDGHAAVWHGYEVHGMEKIPE GAALIIFYHGAIPIDFYYFMAKIFIQKGRTCRVVADHFVFKIPGFSLLLDVFCALHGPRE KCVEILRSGHLLAISPGGVREALLSDETYNIIWGNRKGFAQVAIDAKVPIIPMFTQNIRE GFRSLGGTRLFKWLYEKFRYPFAPMYGGFPVKLRTFLGDPIPYDPKVTAEELAEKTKNAV QALIDKHQRIPGNIRSALLDRFHKEQKAH
Uniprot No.

Target Background

Database Links
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is the basic structure and domain organization of murine TMEM68?

TMEM68 is an integral membrane protein with a complex domain structure. Murine TMEM68 contains a putative acyltransferase domain (residues 111-233) and two transmembrane (TM) domains (residues 51-73 and residues 123-145) . The protein features several conserved motifs characteristic of acyltransferases, including motif I (residues 126-137) and motif IV (residues 225-234) which contain essential active site residues H129, D135, and P229 . Additionally, motifs II (residues 162-171) and III (residues 194-202) are predicted to be important for substrate binding .

How does TMEM68 associate with cellular membranes?

TMEM68 is an integral membrane protein that strongly associates with the endoplasmic reticulum (ER) membrane . Subcellular fractionation experiments with COS-7 cells expressing His6-TMEM68 demonstrate that the protein is exclusively recovered in membrane fractions following high-speed centrifugation (100,000 g) . Membrane extraction assays reveal that TMEM68 remains in the pellet fraction when treated with PBS or sodium carbonate (pH 11.5) but can be solubilized with detergents such as 1% SDS or 1% Triton X-100, confirming its identity as an integral membrane protein rather than a peripheral membrane protein .

What is the membrane topology of TMEM68?

Protease protection assays indicate that both the N- and C-termini of TMEM68 are oriented toward the cytosol . This was determined using COS-7 cells expressing TMEM68 with either an N-terminal His6-tag or a C-terminal FLAG tag. Upon treatment with proteinase K in the absence of detergent, both terminal tags were susceptible to proteolytic degradation, indicating their cytosolic orientation . This topology places the acyltransferase domain in a position to interact with cytosolic substrates while remaining anchored to the ER membrane.

What cloning strategies are recommended for recombinant TMEM68 expression?

Based on experimental protocols in the literature, researchers should begin with RNA isolation from murine tissue using TRIzol® reagent followed by reverse transcription using Oligo(dT)20 primers and SuperScript™ III First-strand Synthesis System . The full-length TMEM68 coding sequence can be amplified using specific primers: forward 5'-ATGATAGATAACAACCAAACCT-3' and reverse 5'-CTAATGAGCCTTCTGCTCTTTAT-3' . PCR conditions should include initial denaturation at 94°C for 4 minutes, followed by 35 cycles of 95°C for 15 seconds, 56°C for 30 seconds, 72°C for 1 minute, and a final extension at 72°C for 10 minutes . The amplified product can be cloned into vectors such as pMD19-T for sequencing, and subsequently into expression vectors such as pcDNA™ 4/HisMax C for N-terminal His6-tagging or pFLAG-CMV-5.1 for C-terminal FLAG-tagging .

Construct Name (Coding Sequence)Primer NamePrimer Sequence (5'-3')
TMEM68-GFP (1–329)TP68F1GCGAATTCGCCATGATAGATAACAACCAAAC
TP68R1CAGGATCCATGAGCCTTCTGCTCTTTAT
TMD1-GFP (51–75)TM1FGCGAATTCGCCATGCTGATACTTTTAATACTTCC
TM1RCAGGATCCCTTGTAGATATGGAGGAAAA
TMD2-GFP (121–145)TM2FGCGAATTCGCCATGGGAGCTGCACTTATAATTTT
TM2RCAGGATCCGATGAAAATTTTAGCCATGA
TMD1+2-GFP(51–145)TM1FGCGAATTCGCCATGCTGATACTTTTAATACTTCC
TM2RCAGGATCCGATGAAAATTTTAGCCATGA

What approaches are most effective for studying TMEM68 subcellular localization?

Confocal fluorescence microscopy using GFP-tagged TMEM68 constructs has proven effective for determining subcellular localization . Studies show that TMEM68-GFP colocalizes with the ER marker DsRed-ER in COS-7 cells, confirming its ER localization . Researchers should consider generating both full-length TMEM68-GFP and domain-specific constructs to assess the contribution of individual domains to localization. For lipid droplet (LD) association studies, cells can be incubated with oleic acid (OA) and stained with LipidTOX Deep Red . When designing experiments, it's critical to include proper controls, such as expressing GFP alone to distinguish between non-specific GFP localization and TMEM68-directed targeting.

How can researchers effectively isolate and analyze membrane-associated TMEM68?

For membrane fractionation studies, researchers should prepare post-nuclear supernatants from cells expressing recombinant TMEM68 and subject them to high-speed centrifugation (100,000 g) to separate membrane and cytosolic fractions . To determine the nature of membrane association, the membrane fraction can be treated with various reagents: PBS (control), 1% SDS (strong detergent), 1% Triton X-100 (mild detergent), or 0.1 M sodium carbonate (pH 11.5, which extracts peripheral membrane proteins) . Following incubation, samples should be separated into pellet and supernatant fractions by centrifugation and analyzed by immunoblotting with appropriate antibodies (anti-His6, anti-FLAG, or anti-GFP, depending on the tag used) . Including controls such as GAPDH (cytosolic marker) and protein disulfide isomerase (PDI, ER lumen marker) is essential for validating fractionation quality .

How do the transmembrane domains contribute to TMEM68 targeting and membrane integration?

The transmembrane domains of TMEM68 play distinct roles in its cellular targeting and membrane integration. Deletion analysis using GFP-tagged TMEM68 mutants lacking either the first (ΔTMD1), second (ΔTMD2), or both (ΔTMD1+2) transmembrane domains demonstrates that TMD1 is particularly important for ER targeting . Constructs expressing only TMD1 fused to GFP (TMD1-GFP) show clear ER localization similar to full-length TMEM68, while TMD2-GFP shows more diffuse localization . This indicates that TMD1 contains sufficient information for proper ER targeting. Membrane fractionation experiments further confirm that TMD1-GFP and TMD1+2-GFP predominantly associate with membrane fractions, whereas the localization pattern of TMD2-GFP is less definitive .

Can individual transmembrane domains of TMEM68 confer ER targeting independently?

Yes, experimental evidence indicates that the first transmembrane domain (TMD1) of TMEM68 can independently target proteins to the ER membrane . When TMD1 (residues 51-75) is fused to GFP, the resulting fusion protein (TMD1-GFP) effectively localizes to the ER as demonstrated by colocalization with the ER marker DsRed-ER . In contrast, TMD2-GFP shows less efficient ER targeting. These findings suggest that TMD1 contains specific sequence or structural elements that facilitate recognition by cellular machinery involved in ER membrane protein insertion. Researchers designing truncated TMEM68 constructs should consider preserving TMD1 to maintain proper subcellular localization .

What experimental approaches can determine the contribution of transmembrane domains to TMEM68 function?

To investigate the functional significance of TMEM68's transmembrane domains, researchers should consider multiple complementary approaches. Deletion mutants lacking specific TMDs (ΔTMD1, ΔTMD2, ΔTMD1+2) can be assessed for proper folding, membrane association, and enzymatic activity . Chimeric constructs, where TMDs from TMEM68 are replaced with those from unrelated proteins, can help determine if the specific sequence is important or if any transmembrane sequence would suffice. Point mutations within the TMDs can identify critical residues for proper folding or function. For these studies, appropriate controls should include wild-type TMEM68 and known ER membrane proteins with similar topology . Researchers should combine biochemical assays (membrane fractionation, enzymatic activity) with imaging approaches (fluorescence microscopy) for comprehensive characterization.

What is the predicted enzymatic function of TMEM68 based on sequence analysis?

Sequence analysis and phylogenetic studies indicate that TMEM68 contains a putative acyltransferase domain (residues 111-233) and belongs to the glycerophospholipid and diacylglycerol acyltransferase family . The protein contains four conserved motifs characteristic of acyltransferases, with motifs I and IV containing critical catalytic residues (H129, D135, and P229) . Phylogenetic alignment using Clustal Ω and clustering analysis positions TMEM68 within the family of glycerophospholipid and diacylglycerol acyltransferases from various species including human, mouse, and fruit fly . Based on its ER localization and predicted enzymatic function, TMEM68 is likely involved in brain glycerolipid metabolism, potentially catalyzing the transfer of acyl groups to glycerol-based lipids .

What is the tissue distribution pattern of TMEM68 in mice?

Quantitative RT-PCR analysis of murine tissues reveals that TMEM68 exhibits tissue-specific expression patterns . Relative transcript levels measured using 36B4 as a reference gene show significant expression in multiple tissues . Notable expression is observed in white adipose tissue (WAT), brown adipose tissue (BAT), skeletal muscle (SM), and cardiac muscle (CM), with statistically significant differences (p<0.05) between certain tissues . This varied expression pattern suggests potential tissue-specific functions for TMEM68, particularly in tissues with active lipid metabolism. Researchers investigating TMEM68 should consider this tissue distribution when designing experiments and selecting appropriate model systems for functional studies .

What experimental approaches would be most effective for determining TMEM68's specific acyltransferase activity?

To characterize TMEM68's putative acyltransferase activity, researchers should employ several complementary approaches. In vitro enzymatic assays using purified recombinant TMEM68 should test various acyl-CoA donors and acceptor substrates, based on its classification within the glycerophospholipid and diacylglycerol acyltransferase family . Site-directed mutagenesis targeting the predicted catalytic residues (H129, D135, P229) can verify their importance for enzymatic function . Lipidomic analysis of cells overexpressing or depleted of TMEM68 can identify affected lipid species. For purification of active TMEM68, researchers should consider using mild detergents or reconstitution into liposomes to maintain the native conformation of the acyltransferase domain. Controls should include enzymatically inactive mutants and related acyltransferases with known activities .

How does TMEM68 compare structurally and functionally to other members of the acyltransferase family?

Phylogenetic analysis places TMEM68 within the glycerophospholipid and diacylglycerol acyltransferase family (pfam01553 and pfam03982) . Unlike LRRTM3, which is a 68 kDa type I transmembrane protein belonging to the LRRTM family and LRR superfamily , TMEM68 contains specific acyltransferase motifs. While LRRTM3 contains leucine-rich repeats, cysteine-rich domains, and a potential N-linked glycosylation site , TMEM68 features four conserved acyltransferase motifs with catalytic residues H129, D135, and P229 . This structural divergence reflects their distinct functions - LRRTM3 is involved in neuronal processes and potentially in BACE1 cleavage of APP , whereas TMEM68 likely participates in glycerolipid metabolism . Researchers should note these differences when designing comparative studies or selecting controls.

What are the critical considerations when designing knockout or knockdown studies for TMEM68?

When planning TMEM68 knockout or knockdown studies, researchers should first consider the tissue-specific expression pattern, with particular attention to tissues showing significant TMEM68 expression, such as WAT, BAT, skeletal muscle, and cardiac muscle . Given TMEM68's putative role in glycerolipid metabolism , phenotypic analyses should include comprehensive lipidomic profiling to identify altered lipid species. Controls should include rescue experiments with wild-type TMEM68 and catalytically inactive mutants (H129A, D135A, P229A) . Researchers should monitor both acute and chronic effects, as compensatory mechanisms involving related acyltransferases might emerge over time. For tissue-specific studies, conditional knockout approaches may be preferable to avoid potential developmental effects. Careful validation of knockout/knockdown efficiency at both mRNA and protein levels is essential for proper interpretation of results.

What biochemical challenges might researchers encounter when working with recombinant TMEM68, and how can these be addressed?

As an integral membrane protein with two transmembrane domains, TMEM68 presents several biochemical challenges . For successful expression and purification, researchers should consider using mammalian expression systems (e.g., COS-7 cells) that have been proven effective for TMEM68 . Membrane extraction requires careful selection of detergents - while 1% SDS and 1% Triton X-100 can solubilize TMEM68 , milder detergents might be preferable for maintaining enzymatic activity. For structural studies, researchers might need to design constructs lacking the transmembrane domains while preserving the acyltransferase domain (residues 111-233) . When assessing enzymatic activity, both the membrane environment and the cytosolic orientation of the N- and C-termini should be considered . Control experiments should include known acyltransferases with similar membrane topology to benchmark purification and activity assay conditions.

What are common issues in TMEM68 localization studies, and how can these be resolved?

When conducting subcellular localization studies with TMEM68, researchers might encounter several challenges. Overexpression artifacts can lead to protein mislocalization or aggregation; this can be addressed by using inducible expression systems or lower expression levels . Background fluorescence with GFP-tagged constructs can complicate interpretation; using appropriate controls (GFP alone) and quantitative colocalization analysis is essential . Fixation procedures might alter membrane protein distribution; comparing live-cell imaging with fixed samples is recommended. If TMEM68 trafficking is being studied, temperature blocks or specific inhibitors of vesicular transport can help distinguish between direct ER targeting and post-translational redistribution. For optimal results, researchers should co-express established organelle markers (e.g., DsRed-ER for endoplasmic reticulum) and use high-resolution imaging techniques such as confocal microscopy .

How should researchers address potential pitfalls in membrane fractionation experiments with TMEM68?

Membrane fractionation experiments with TMEM68 require careful attention to several potential pitfalls. Incomplete membrane solubilization can lead to false-negative results in detergent extraction experiments; researchers should optimize detergent concentrations and incubation conditions . Cross-contamination between membrane and cytosolic fractions can confound interpretation; multiple markers should be used to verify fraction purity (e.g., GAPDH for cytosol, calnexin or PDI for ER) . Proteolytic degradation during fractionation can lead to loss of signal; protease inhibitors should be included in all buffers. For quantitative comparisons, researchers should normalize TMEM68 detection to appropriate loading controls for each fraction. When studying mutant constructs, expression levels might vary; western blot analysis of total cell lysates should be performed prior to fractionation to ensure comparable expression. These precautions will help ensure reliable and interpretable results from membrane fractionation studies.

What are the most promising approaches for elucidating TMEM68's specific substrates and products?

Given TMEM68's putative acyltransferase function and ER localization , researchers should employ targeted lipidomic approaches to identify its specific substrates and products. In vitro enzymatic assays using purified TMEM68 should systematically test various acyl-CoA donors and glycerolipid acceptors, focusing particularly on brain-specific lipid species. Metabolic labeling with isotope-tagged precursors in cells overexpressing or depleted of TMEM68 can help track specific lipid synthesis pathways. Structure-guided approaches, based on the conserved catalytic residues H129, D135, and P229 , might predict substrate binding modes. Comparative studies with related acyltransferases could provide insights into substrate specificity determinants. Cross-linking mass spectrometry might capture transient enzyme-substrate complexes. These complementary approaches would help define TMEM68's enzymatic function with greater precision.

How might tissue-specific functions of TMEM68 be investigated in depth?

To investigate tissue-specific functions of TMEM68, researchers should build upon the expression data showing significant presence in WAT, BAT, skeletal muscle, and cardiac muscle . Tissue-specific conditional knockout models would help avoid potential developmental effects of global TMEM68 deletion. Single-cell transcriptomics could identify specific cell populations with high TMEM68 expression within tissues, providing more precise targets for functional studies. Ex vivo tissue explants or primary cell cultures from multiple tissues could be used to compare TMEM68 regulation and function across tissues. Tissue-specific lipid profiling in normal versus TMEM68-depleted conditions might reveal tissue-dependent lipid alterations. For brain-specific functions, region-specific analysis is warranted given TMEM68's predicted role in brain glycerolipid metabolism . Integration of these approaches would provide a comprehensive understanding of TMEM68's tissue-specific roles.

What technological advancements would most benefit future TMEM68 research?

Several emerging technologies could significantly advance TMEM68 research. Cryo-electron microscopy could elucidate the membrane-embedded structure of TMEM68, particularly the arrangement of its transmembrane domains and acyltransferase domain . Advanced mass spectrometry techniques with increased sensitivity could identify low-abundance lipid species affected by TMEM68 activity. CRISPR-based screening approaches could identify genes that functionally interact with TMEM68. Proximity labeling methods (BioID, APEX) could map the TMEM68 interaction network within the ER membrane. Microfluidic systems allowing high-throughput testing of enzymatic substrates would accelerate identification of TMEM68's specific activity. Development of specific small-molecule inhibitors would enable acute perturbation of TMEM68 function. These technological advancements would collectively address current knowledge gaps regarding TMEM68 structure, function, and biological significance.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.