Recombinant Mouse Transmembrane protein 69 (Tmem69)

Shipped with Ice Packs
In Stock

Description

Introduction to Mouse Transmembrane Protein 69

Mouse Transmembrane protein 69 (Tmem69) is a protein encoded by the Tmem69 gene, also known as A630048M13Rik in mice . The gene has been mapped and characterized with specific identifiers including Gene ID 230657, mRNA reference sequence NM_177670.4, and protein reference sequence NP_808338.2 . The corresponding UniProt ID for mouse Tmem69 is Q3KQJ0, which allows for standardized reference across research databases .

Tmem69 belongs to a family of transmembrane proteins with conserved domains across species. While the precise biological function of Tmem69 remains incompletely characterized, structural analyses reveal it contains multiple transmembrane segments that anchor it within cellular membranes . This transmembrane localization suggests potential roles in cellular signaling, membrane organization, or transport functions.

Research into Tmem69 has expanded significantly with the development of recombinant protein technologies, allowing for more detailed investigation of this protein's structure and function in controlled experimental settings.

Protein Structure

Mouse Tmem69 shares structural similarities with its human ortholog, which consists of 247 amino acids . A defining characteristic of Tmem69 is the presence of five transmembrane segments, which enable its integration into cellular membranes . These hydrophobic domains traverse the lipid bilayer, with intervening segments extending into either the cytoplasmic or extracellular/luminal spaces.

Analysis of the protein reveals it belongs to the Protein of unknown function DUF3429 family (InterPro ID: IPR021836), a designation that highlights our still-evolving understanding of its precise biological role . Despite this functional uncertainty, the conservation of this domain across species suggests evolutionary importance.

Functional Domains

While specific functional domains within mouse Tmem69 require further characterization, data from related orthologs provide valuable insights. Research suggests Tmem69 may function as a scaffolding protein within G-protein coupled receptor complexes, potentially participating in signal transduction pathways . In Xenopus tropicalis, the Tmem69 ortholog has been observed to form a cluster with the xtGPR54-2 gene IPP and GPBP1 in scaffold_41, comprising part of a receptor complex for kisspeptin in brain cell plasma membranes .

This potential involvement in kisspeptin signaling is particularly noteworthy, as this pathway plays crucial roles in reproductive physiology and puberty onset across vertebrate species.

Expression Systems

Recombinant mouse Tmem69 can be produced using various expression systems, each offering distinct advantages depending on research requirements. Available systems include:

  1. Cell-free expression systems, which provide rapid protein synthesis without cellular constraints

  2. E. coli-based bacterial expression, offering cost-effective high-yield production

  3. Yeast expression systems, which provide eukaryotic post-translational modifications

  4. Baculovirus-infected insect cells, suitable for complex mammalian proteins

  5. Mammalian cell expression (particularly HEK293 cells), which provides the most native-like post-translational modifications

The choice of expression system significantly impacts protein folding, post-translational modifications, and ultimately the biological activity of the recombinant protein.

Purification and Quality Control

Standard purification protocols for recombinant mouse Tmem69 typically achieve greater than 85% purity as determined by SDS-PAGE analysis . For specialized applications, higher purity preparations (>90%) are available . The recombinant protein is commonly tagged with affinity markers such as polyhistidine (His-tag) to facilitate purification and downstream applications .

Commercial preparations of recombinant mouse Tmem69 undergo rigorous quality control to ensure consistency and reproducibility in research applications. This includes verification of protein identity, purity assessment, and functional testing where applicable.

Research Applications

Recombinant mouse Tmem69 serves as a valuable tool for investigating protein-protein interactions, signaling pathways, and membrane biology. Key applications include:

  1. Protein interaction studies: Identifying binding partners that may elucidate Tmem69's biological function

  2. Antibody production: Generating specific antibodies for detection and localization studies

  3. Structural biology: Providing purified protein for crystallographic or cryo-EM studies

  4. Functional assays: Examining potential roles in cellular signaling or transport functions

One particularly versatile format is recombinant Tmem69 pre-coupled to magnetic beads, which enables efficient capture of target molecules with high specificity and facilitates magnetic separation in various experimental workflows .

Technical Applications

The pre-coupled magnetic bead format of recombinant mouse Tmem69 offers numerous technical advantages in laboratory applications:

ApplicationDescriptionBenefits
ImmunoassayDetection of target analytes using antibody-based techniquesHigh specificity and sensitivity for target molecules
In vitro diagnosticsDevelopment of diagnostic tests for research or clinical applicationsReproducible results with standardized reagents
Cell sortingIsolation of specific cell populations based on surface markersGentle separation with minimal cellular stress
ImmunoprecipitationPurification of protein complexes from cellular lysatesEfficient capture with reduced background
Protein/antibody purificationIsolation of specific proteins from complex mixturesRapid separation using magnetic techniques

The uniform particle size (~2 μm) and narrow size distribution of these magnetic beads, coupled with their hydrophilic surface, create ideal conditions for capturing target molecules with high specificity .

Product Formats

Recombinant mouse Tmem69 is available in several commercial formats to accommodate diverse research needs:

  1. Purified recombinant protein: Available as lyophilized powder or in solution

  2. Pre-coupled magnetic beads: Ready-to-use format for immunoprecipitation and separation applications

  3. Partial protein fragments: Specific domains for targeted applications

  4. Tagged variants: Proteins with various affinity tags (His, Fc, Avi) for detection and purification

Related Research Tools

A comprehensive ecosystem of research tools has been developed to facilitate investigation of mouse Tmem69:

  1. ELISA kits: For quantitative detection of mouse Tmem69 in various biological samples

  2. Antibodies: Polyclonal and monoclonal antibodies for detection in Western blot, immunohistochemistry, and other applications

  3. siRNA: Small interfering RNA for knockdown studies to investigate function

  4. cDNA clones: For expression studies and genetic manipulation

The availability of these complementary tools enables multifaceted approaches to investigating Tmem69 function and interactions.

Species Conservation

Tmem69 demonstrates evolutionary conservation across vertebrate species, suggesting fundamental biological importance. Orthologs have been identified in:

  1. Humans: TMEM69 (C1orf154) on chromosome 1p34.1

  2. Mice: Tmem69 (A630048M13Rik)

  3. Zebrafish: tmem69 on chromosome 6

  4. Xenopus tropicalis: tmem69 with potential roles in kisspeptin signaling

This conservation provides opportunities for comparative studies to elucidate function across evolutionary lineages.

Knowledge Gaps

Despite advances in characterizing Tmem69, significant knowledge gaps remain:

  1. The precise biological function of mouse Tmem69 remains incompletely understood

  2. The complete interactome (set of interacting proteins) is yet to be established

  3. Potential roles in development, physiology, or pathological conditions require further investigation

  4. The regulatory mechanisms controlling Tmem69 expression need clarification

The continued development and application of recombinant Tmem69 research tools will play a crucial role in addressing these knowledge gaps.

Emerging Research Directions

Based on preliminary findings from related orthologs, several promising research directions emerge:

  1. Investigation of potential roles in G-protein coupled receptor signaling pathways

  2. Examination of possible functions in kisspeptin-mediated reproductive biology

  3. Exploration of membrane organization and transport functions

  4. Development of conditional knockout models to assess tissue-specific functions

Product Specs

Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have a specific format preference, please indicate your requirement during order placement, and we will accommodate your request.
Lead Time
Delivery time may vary depending on the purchasing method or location. Please consult your local distributors for specific delivery timelines.
Note: Our proteins are shipped with standard blue ice packs by default. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
It is recommended to briefly centrifuge the vial prior to opening to ensure the contents settle to the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer components, temperature, and the intrinsic stability of the protein.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
Tmem69; Transmembrane protein 69
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-245
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Tmem69
Target Protein Sequence
MLHFIQKVSGASSKMLKNPFTVRLGAGRIDILSLKTCLLQNFSSLPPRTWLSPSFQVCMR KIQCYHVSPCNFKKQKAVLPPKKRSTITYLLDSPKPALYITLAGLIPFTAPPLLMVITKS YIPVLAFTQMAYGAGFLAFLGGIRWGFVLPESSPAKPDYINLASSMSPILFSWAAILFSE RLNEAIVTLIIGLGIALHNELFLLPHYPNWFKALRIVSTLVAFISFVVTLILENIYPEKG PKRPD
Uniprot No.

Target Background

Database Links
Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is the molecular structure of Mouse Tmem69?

Mouse Transmembrane protein 69 (Tmem69) is characterized by the presence of five transmembrane segments, similar to its human ortholog TMEM69. The protein features both extracellular and intracellular domains connected by these transmembrane regions. Based on the human ortholog, Mouse Tmem69 likely has a molecular weight around 27.6 kDa with an isoelectric point of approximately 10.3, indicating it is a basic protein . The five transmembrane segments are key structural features that anchor the protein within cellular membranes and likely play important roles in its biological function.

Where is the Tmem69 gene located in the mouse genome?

While specific information about mouse Tmem69 genomic location is limited in the current literature, we can infer its organization based on the human ortholog. The human TMEM69 gene is located on chromosome 1p34.1, spans approximately 7.24 kb on the plus strand, and contains 3 exons encoding a primary mRNA transcript of 6262 bp in length . The mouse ortholog would be expected to have a similar exon-intron structure, though mapping to the corresponding mouse chromosome. Researchers should verify the precise location using mouse genome databases before designing targeting constructs or genomic analysis experiments.

How does Mouse Tmem69 compare to human TMEM69?

Mouse Tmem69 shares significant sequence and structural homology with human TMEM69. Human TMEM69 is a 247 amino acid protein featuring five transmembrane segments . While exact sequence identity percentages between mouse and human orthologs are not specified in current literature, transmembrane domains typically show higher conservation across species compared to loop regions. Both proteins are expected to share similar functional properties, including potential roles in G-protein coupled receptor complexes . Researchers can use resources like HomoloGene (ID: 9531) to further explore evolutionary relationships and conservation patterns .

What expression systems are optimal for producing recombinant Mouse Tmem69?

For recombinant production of Mouse Tmem69, researchers should consider expression systems optimized for multi-pass transmembrane proteins. Due to the presence of five transmembrane segments , the following expression systems are recommended:

Expression SystemAdvantagesChallengesBest Applications
Mammalian cells (HEK293, CHO)Native-like membrane environment, proper post-translational modificationsLower yields, higher costFunctional studies, interaction analyses
Insect cells (Sf9, Hi5)Higher yields than mammalian systems, eukaryotic processingDifferent glycosylation patternsStructural studies, antibody production
Yeast (Pichia pastoris)High yields, eukaryotic processing capabilityMay require codon optimizationLarge-scale production, certain functional assays
E. coli with specialized strainsHighest yields, cost-effectiveOften requires refolding, lacks mammalian PTMsDomain studies, initial characterization

For research requiring native-like properties, mammalian expression systems are preferred despite lower yields. When a tagged version is required, an N-terminal tag approach similar to that used for other recombinant mouse proteins may be employed .

What purification strategies yield functional recombinant Mouse Tmem69?

Purification of recombinant Mouse Tmem69 requires specialized approaches for membrane proteins with multiple transmembrane domains. A recommended purification workflow includes:

  • Membrane isolation: Differential centrifugation to isolate membrane fractions containing the expressed protein

  • Solubilization: Extraction using mild detergents like DDM, LMNG, or digitonin that preserve native structure

  • Affinity chromatography: His-tag purification (similar to methods used for other recombinant mouse proteins ) with detergent-containing buffers

  • Size exclusion chromatography: To separate properly folded protein from aggregates and remove detergent micelles

  • Reconstitution: Transfer into lipid nanodiscs or proteoliposomes for functional studies

Quality control should include SDS-PAGE analysis under both reducing and non-reducing conditions to assess protein integrity and oligomeric state . Western blotting with specific antibodies against Tmem69 or affinity tags should be performed to confirm protein identity.

How can researchers validate proper folding of recombinant Mouse Tmem69?

Validation of properly folded recombinant Mouse Tmem69 requires multiple complementary approaches:

  • Structural validation:

    • Circular dichroism spectroscopy to confirm α-helical content consistent with transmembrane domains

    • Limited proteolysis to assess compact folding and domain organization

    • Thermal stability assays (differential scanning fluorimetry) to evaluate protein stability

  • Functional validation:

    • Binding assays with potential interaction partners (using approaches similar to those employed for other transmembrane proteins )

    • Reconstitution into liposomes to assess membrane integration

    • Cell-based assays examining Tmem69's putative role in G-protein coupled receptor signaling

  • Biochemical validation:

    • Mass spectrometry to confirm protein identity and post-translational modifications

    • Size exclusion chromatography with multi-angle light scattering to assess oligomeric state

    • Dynamic light scattering to evaluate sample homogeneity

Each validation method provides complementary information, and researchers should employ multiple approaches before proceeding to functional studies.

What are the current hypotheses regarding Tmem69 function?

Current literature suggests several potential functions for Tmem69, though detailed characterization remains limited:

  • Scaffold protein: Evidence from comparative studies suggests Tmem69 may function as a scaffolding protein in G-coupled protein receptor complexes . In Xenopus tropicalis, it has been shown to form a cluster with xtGPR54-2, IPP, and GPBP1, potentially forming part of a receptor complex for kisspeptin in brain cell plasma membranes .

  • Membrane organization: The presence of five transmembrane segments suggests a potential role in membrane organization or compartmentalization .

  • Signal transduction: By analogy with other transmembrane proteins like Tmem169, which interacts with key neuronal proteins implicated in neurodevelopmental diseases , Tmem69 may participate in specialized signaling pathways.

These hypotheses remain to be fully validated through targeted experimental approaches, including knockout/knockdown studies, interaction mapping, and functional assays in relevant cell systems.

How should experiments be designed to investigate Tmem69's role in receptor complexes?

To investigate Tmem69's potential role in receptor complexes, particularly G-protein coupled receptor complexes , researchers should employ a multi-faceted experimental strategy:

  • Protein-protein interaction studies:

    • Co-immunoprecipitation of Tmem69 with suspected GPCR partners

    • Proximity labeling approaches (BioID, APEX) to identify proteins in the vicinity of Tmem69

    • FRET/BRET assays to monitor direct interactions in living cells

  • Functional signaling studies:

    • Calcium mobilization assays in cells with normal or depleted Tmem69 levels

    • cAMP measurement in response to GPCR activation

    • β-arrestin recruitment assays with and without Tmem69

  • Structural approaches:

    • Cross-linking mass spectrometry to map interaction interfaces

    • Single-particle cryo-EM of purified complexes

    • Computational modeling of potential interaction modes

Appropriate controls should include Tmem69 knockdown/knockout cells (using siRNA approaches similar to those employed for other TMEM proteins ), mutations in key residues predicted to mediate interactions, and pharmacological modulators of specific GPCR pathways.

What knockout or knockdown strategies are most effective for studying Tmem69 function?

For investigating Tmem69 function through loss-of-function approaches, researchers should consider several complementary strategies:

  • CRISPR/Cas9 gene editing:

    • Complete knockout models to assess developmental and physiological consequences

    • Conditional knockout (using Cre-lox systems) to study tissue-specific or temporal roles, similar to cortex-specific approaches used for Tmem169

    • Precise point mutations to examine specific functional domains

  • RNA interference approaches:

    • siRNA transient knockdown using sequences targeting mouse Tmem69 (designing approaches similar to those used for other TMEM proteins )

    • shRNA for stable knockdown in cultured cells or in vivo

    • Inducible RNAi systems for temporal control of knockdown

Each approach offers distinct advantages and limitations:

ApproachAdvantagesLimitationsVerification Methods
CRISPR/Cas9Complete protein elimination, heritable modificationsPotential developmental compensation, off-target effectsGenomic sequencing, Western blot, qRT-PCR
siRNA/shRNARapid implementation, tunable knockdown levelsIncomplete knockdown, transient effectsqRT-PCR, Western blot
Conditional knockoutSpatial and temporal controlComplex breeding schemes, incomplete recombinationPCR genotyping, immunohistochemistry

Verification of knockdown/knockout efficiency should utilize qRT-PCR with primers specific to mouse Tmem69 and Western blotting with validated antibodies.

How can bioinformatic approaches predict Tmem69 interaction partners?

Predicting interaction partners for Tmem69 can leverage various bioinformatic approaches:

  • Sequence-based methods:

    • Interolog mapping based on known interactions of orthologs

    • Motif-based prediction of binding sites

    • Co-evolution analysis to identify correlated mutations across protein families

  • Genomic data integration:

    • Co-expression analysis across tissues and conditions (similar to approaches used for TMEM genes in pancreatic cancer )

    • Phylogenetic profiling to identify genes with similar evolutionary patterns

    • Machine learning approaches using multiple data types (as employed in TMEM gene studies )

  • Structural prediction:

    • Homology modeling of Tmem69 structure

    • Protein-protein docking simulations

    • Molecular dynamics to assess interaction stability

The machine learning approaches described for other TMEM proteins, including LASSO regression, Support Vector Machine-Recursive Feature Elimination (SVM-RFE), and random forest analysis , can be adapted to predict Tmem69 interactions and functional networks. Predictions should be validated experimentally using approaches described in section 3.2.

What cell models best represent native Tmem69 function for in vitro studies?

Selection of appropriate cell models for studying Mouse Tmem69 should be guided by expression patterns and functional context:

  • Primary considerations:

    • Endogenous expression levels of Tmem69

    • Presence of interaction partners (particularly GPCRs if investigating receptor complex functions )

    • Tissue relevance to hypothesized functions

  • Recommended cell models:

    • Primary neuronal cultures (if investigating functions similar to Tmem169 in the nervous system )

    • Mouse embryonic fibroblasts (MEFs)

    • Cell lines derived from tissues with high Tmem69 expression

  • Model validation approaches:

    • Confirm Tmem69 expression by qRT-PCR using validated primers

    • Characterize subcellular localization by immunofluorescence

    • Verify expression of key interaction partners

Researchers should consider using multiple cell models to ensure findings are not cell-type specific, and validate key findings in primary cells when possible. If studying neuronal functions, cortical neuron models may be particularly relevant based on findings from related transmembrane proteins .

How can evolutionary conservation analysis inform Tmem69 functional studies?

Evolutionary conservation analysis provides valuable insights into functionally important regions of Tmem69:

  • Sequence conservation approaches:

    • Multiple sequence alignment across species to identify conserved residues

    • Conservation scoring to highlight functionally important regions

    • Analysis of transmembrane domain conservation versus loop regions

  • Structural feature conservation:

    • Conservation of predicted secondary structure elements

    • Maintenance of charge distribution patterns

    • Preservation of post-translational modification sites

Conservation patterns typically reveal:

  • Core functional domains (highest conservation)

  • Species-specific adaptations (variable regions)

  • Critical interaction interfaces

  • Regulatory regions important for expression control

What are the challenges in crystallizing recombinant Mouse Tmem69?

Crystallization of Mouse Tmem69 presents several challenges typical of multi-pass transmembrane proteins with five transmembrane segments :

  • Detergent selection:

    • Finding detergents that maintain protein stability while allowing crystal contacts

    • Balancing micelle size with crystal packing requirements

    • Managing detergent phase separation during crystallization

  • Protein stability and homogeneity:

    • Maintaining stability throughout purification and crystallization

    • Achieving conformational homogeneity

    • Preventing aggregation during concentration

  • Crystal packing challenges:

    • Limited potential crystal contacts due to detergent micelles

    • Hydrophobic transmembrane regions reducing water-mediated crystal contacts

    • Potential flexibility in loop regions

Alternative structural approaches to consider include:

Structural MethodAdvantagesLimitationsSample Requirements
Cryo-electron microscopyNo crystallization required, captures multiple statesLower resolution for smaller proteins50-100 μg highly pure protein
NMR spectroscopyProvides dynamic information, works in membrane mimeticsLimited by protein sizeIsotope-labeled protein, mg quantities
X-ray free electron laserCan use microcrystals, room temperature structuresLimited facility accessNumerous microcrystals
Computational modelingAccessible, integrates experimental constraintsAccuracy limited by templatesValidation with experimental data

For Tmem69 specifically, researchers might consider generating fusion constructs with crystallization chaperones or focusing on specific domains if the full-length protein proves refractory to crystallization.

How can researchers distinguish between specific and non-specific interactions in Tmem69 binding studies?

Differentiating specific from non-specific interactions in Tmem69 binding studies requires rigorous experimental design and appropriate controls:

  • Essential controls:

    • Negative controls: Unrelated transmembrane proteins with similar properties

    • Competition assays: Unlabeled protein should compete with labeled protein

    • Concentration dependence: Specific interactions typically show saturation kinetics

    • Mutation controls: Mutations in predicted binding interfaces should reduce specific interactions

  • Quantitative approaches:

    • Determine binding affinity constants (Kd) for putative interactions

    • Compare binding parameters across related proteins

    • Assess binding kinetics (kon/koff rates) similar to analyses performed for mouse CD69 binding to Galectin-1

  • Data analysis considerations:

    • Apply appropriate statistical tests to distinguish signal from background

    • Use multiple biological and technical replicates

    • Consider using machine learning approaches to identify pattern signatures of true interactions, similar to approaches used in other TMEM protein studies

For validation, researchers should demonstrate that binding is dependent on specific protein domains and that mutating key residues abolishes interaction. Furthermore, showing that the interaction occurs at physiologically relevant concentrations and conditions provides additional evidence for specificity.

How might understanding Tmem69 function contribute to disease research?

While the specific role of Tmem69 in disease remains to be fully elucidated, research on related transmembrane proteins suggests several potential contributions to disease understanding:

  • Neurological disorders: Given that related transmembrane proteins like Tmem169 have been implicated in neuronal morphological abnormalities and synaptic dysfunction with behavioral traits resembling autism , Tmem69 might similarly participate in neurological pathways relevant to neurodevelopmental disorders.

  • Receptor signaling pathologies: If Tmem69 functions as a scaffolding protein in G-protein coupled receptor complexes as suggested , it may influence various signaling pathways relevant to conditions ranging from metabolic disorders to neuropsychiatric conditions.

  • Cancer biology: Other transmembrane protein genes have been identified as differentially expressed in cancers like pancreatic ductal adenocarcinoma , suggesting potential roles in disease progression or as biomarkers.

Research approaches similar to those applied for Tmem169 in autism models or TMEM genes in cancer could be adapted to investigate potential roles of Tmem69 in disease processes, potentially revealing new therapeutic targets or diagnostic markers.

What methodological approaches can assess Tmem69 interactions with small molecules?

To investigate potential interactions between Tmem69 and small molecules, researchers should consider these methodological approaches:

  • Binding assays:

    • Thermal shift assays to detect ligand-induced stability changes

    • Surface plasmon resonance with immobilized Tmem69

    • Microscale thermophoresis for solution-based binding measurements

    • Isothermal titration calorimetry for thermodynamic parameters

  • Functional assays:

    • Cell-based reporter assays if Tmem69 participates in signaling pathways

    • Electrophysiology if Tmem69 forms or modulates ion channels

    • Conformational change detection using engineered sensors

  • Structural approaches:

    • Co-crystallization with potential ligands

    • Hydrogen-deuterium exchange mass spectrometry to detect binding interfaces

    • NMR-based screening for fragment binding

  • Computational methods:

    • Molecular docking to predicted binding pockets

    • Molecular dynamics simulations to assess binding stability

    • Pharmacophore modeling based on known interactors

These approaches can identify compounds that modulate Tmem69 function, potentially providing both research tools and starting points for therapeutic development if Tmem69 is validated as a disease-relevant target.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.