Recombinant Mouse Transmembrane protein 74 (Tmem74)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires advance notice and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Tmem74; Transmembrane protein 74
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-305
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Tmem74
Target Protein Sequence
MELHSLSKRNSPVDPCNALEWSSGETSGDHIEEATIRDAFCYQKNLVSTPRADVVEVCRL STSPASPTSLLQDSAIQTSFSLSGPPDSGNNQVMADRKVCNCCSQELETSFTYVDENVNL EQRSQRSPSAKGSNHPVDLGWGNPNEWSHETAMSLMSEDDDDTSSEATSSGKSVDYGFIS AILFLVTGILLVIISYIVPREVTVDPNTVAAREMERLEKESAMLGAHLDRCVIAGLCLLT LGGVVLSCLLMMSMWKGELYRRNRFASSKESAKLYGSFNFRMKTSTNEDTLELSLVEEDA LAVQS
Uniprot No.

Target Background

Function

TMEM74 plays a crucial role in autophagy, a process potentially involving PI3K signal transduction.

Database Links
Protein Families
TMEM74 family
Subcellular Location
Lysosome membrane; Multi-pass membrane protein. Cytoplasmic vesicle, autophagosome membrane; Multi-pass membrane protein.

Q&A

What is Transmembrane protein 74 (TMEM74) and what are its key functions?

Transmembrane protein 74 (TMEM74) is a type 2 transmembrane glycoprotein that plays an essential role in autophagy regulation. It belongs to the TMEM74 family and functions as a novel positive modulator of autophagy . TMEM74 has been shown to increase the autophagic flux process in different tumor cell lines and interacts with key autophagy-related proteins ATG16L1 and ATG9A . Unlike conventional autophagy pathways, TMEM74-related autophagy operates through a unique mechanism independent of the BECN1/PI3KC3 complex and ULK1, which are typically required for autophagy initiation . This distinctive pathway represents an alternative mechanism for autophagy induction that has significant implications for cellular survival, particularly in cancer contexts.

How does TMEM74 compare to other transmembrane proteins in terms of structure and function?

TMEM74 is part of a larger family of transmembrane proteins (TMEMs) that have diverse roles in cell biology. While many TMEMs (such as TMEM45B, TMEM119, and TMEM98) function primarily in cell proliferation, migration, or invasion pathways , TMEM74 specifically regulates autophagy through direct interactions with autophagy machinery proteins . The structural arrangement of TMEM74 enables these protein-protein interactions that are crucial for its autophagy-inducing function. Unlike some other TMEMs that may operate through Wnt/β-catenin signaling (such as TMEM88) or metabolism regulation (such as TMEM180) , TMEM74 appears specialized for autophagy modulation. This functional specificity makes TMEM74 unique within the TMEM family and highlights its importance in autophagy research.

What are standard methods for expressing and purifying recombinant mouse TMEM74?

For expressing and purifying recombinant mouse TMEM74, researchers typically employ similar approaches to those used for other recombinant mouse proteins :

  • Expression System Selection:

    • E. coli-based systems are commonly used for cost-effective production

    • Mammalian expression systems (like HEK293 or CHO cells) may preserve post-translational modifications

    • Baculovirus-insect cell systems offer advantages for membrane protein expression

  • Vector Design Considerations:

    • Include appropriate tags (e.g., 6xHis, Fc) for purification and detection

    • Consider using fusion partners to enhance solubility

    • Include protease cleavage sites for tag removal if necessary

  • Purification Strategy:

    • Affinity chromatography using tag-specific resins (Ni-NTA for His-tagged proteins)

    • Size-exclusion chromatography for further purification

    • Ion-exchange chromatography to remove contaminants

  • Quality Control Methods:

    • SDS-PAGE to assess purity

    • Western blotting to confirm identity

    • Mass spectrometry for accurate molecular weight determination

    • Functional assays to verify biological activity

  • Storage Recommendations:

    • Lyophilized formulation or in buffer containing stabilizers

    • Storage at -80°C with minimal freeze-thaw cycles

    • Addition of glycerol (10%) for long-term stability

Proper expression and purification are critical for obtaining functional recombinant TMEM74 for experimental applications.

How should I design a robust experiment to study TMEM74's autophagy-inducing function?

When designing experiments to study TMEM74's autophagy-inducing function, follow these structured guidelines:

  • Hypothesis Formulation:

    • Develop a specific hypothesis about TMEM74's role in autophagy

    • Ensure the hypothesis is testable and addresses a specific aspect of TMEM74 function

  • Experimental Groups Design:

    • Control Groups :

      • Negative control: Vehicle or inactive protein

      • Positive control: Known autophagy inducer (e.g., rapamycin, starvation)

      • Genetic controls: ATG16L1 or ATG9A knockdowns to verify specific pathway

    • Experimental Groups:

      • Different concentrations of recombinant TMEM74

      • TMEM74 with inhibitors of conventional autophagy pathways

      • TMEM74 under different cellular stress conditions

  • Data Collection Planning :

    • Autophagy Markers Assessment:

      • LC3-I to LC3-II conversion (Western blot)

      • p62/SQSTM1 degradation (Western blot)

      • GFP-LC3 puncta formation (Fluorescence microscopy)

      • Autophagic flux using tandem mRFP-GFP-LC3 reporters

    • Interaction Studies:

      • Co-immunoprecipitation with ATG16L1 and ATG9A

      • Immunofluorescence co-localization

  • Observation Parameters :

    • Time-course measurements to capture autophagy dynamics

    • Dose-response relationships to establish efficacy thresholds

    • Cell-type specificity to determine context-dependent effects

  • Validation Approaches:

    • Replicate key findings in multiple cell lines

    • Use genetic approaches (siRNA, CRISPR) to complement protein treatment

    • Apply pharmacological inhibitors to verify pathway specificity

This comprehensive experimental approach ensures robust evaluation of TMEM74's autophagy-inducing function while addressing potential confounding variables .

What controls are essential when studying recombinant TMEM74 in autophagy assays?

When studying recombinant TMEM74 in autophagy assays, the following controls are essential:

Control TypeExamplePurposeImplementation
Vehicle ControlsBuffer-only treatmentControls for effects of protein carrier solutionUse the same buffer composition and volume as TMEM74 treatment
Positive ControlsRapamycin, amino acid starvationVerifies that autophagy detection methods work properlyInclude standard autophagy inducers at established concentrations
Negative Controls3-methyladenine, wortmanninConfirms specificity of autophagy measurementsApply autophagy inhibitors to validate pathway specificity
Protein ControlsHeat-denatured TMEM74, irrelevant recombinant proteinControls for non-specific effects of protein additionUse proteins of similar size/structure but without autophagy function
Flux ControlsBafilomycin A1, chloroquineDistinguishes between autophagy induction and blockadeAdd lysosomal inhibitors to measure autophagic flux
Genetic ControlsATG5/ATG7 knockout cells, ATG16L1/ATG9A knockdownValidates pathway dependencyTest TMEM74 effects in cells lacking key autophagy components
Dose ControlsMultiple TMEM74 concentrationsEstablishes dose-response relationshipTest a range of concentrations (e.g., 0.1-10 μg/mL)
Time ControlsMultiple time pointsCaptures autophagy dynamicsMeasure outcomes at several intervals (e.g., 2, 6, 12, 24 hours)

These controls ensure experimental rigor by addressing potential artifacts, non-specific effects, and establishing causality in TMEM74-induced autophagy studies . Incorporating these controls systematically strengthens the validity and reproducibility of findings related to TMEM74's autophagy-modulating activities.

How can I assess the interaction between TMEM74 and its binding partners ATG16L1/ATG9A?

To rigorously assess the interactions between TMEM74 and its binding partners ATG16L1/ATG9A, implement a multi-faceted approach:

  • Biochemical Interaction Assays:

    • Co-immunoprecipitation (Co-IP): Precipitate TMEM74 and probe for ATG16L1/ATG9A, and vice versa for reciprocal confirmation

    • Pull-down assays: Use purified recombinant TMEM74 as bait to capture partners from cell lysates

    • Surface Plasmon Resonance (SPR): Determine binding kinetics and affinity constants

    • Isothermal Titration Calorimetry (ITC): Provide thermodynamic parameters of binding

  • Structural Characterization:

    • Deletion mapping: Create truncated versions of TMEM74 to identify binding domains

    • Site-directed mutagenesis: Identify critical residues for interaction

    • Hydrogen-deuterium exchange mass spectrometry: Map interaction interfaces

    • Crosslinking coupled with mass spectrometry: Identify proximal residues

  • Cellular Localization Studies:

    • Immunofluorescence microscopy: Visualize co-localization of TMEM74 with partners

    • Proximity ligation assay (PLA): Detect protein interactions with spatial resolution

    • FRET/BRET assays: Measure real-time interactions in living cells

    • Super-resolution microscopy: Achieve nanoscale resolution of interaction sites

  • Functional Validation:

    • Mutation effects: Assess how binding-deficient mutants affect autophagy induction

    • Competition assays: Determine if peptides derived from interaction domains disrupt function

    • Rescue experiments: Test if ATG16L1/ATG9A can restore function in respective knockdown cells

    • Domain swapping: Exchange binding domains to confirm functional relevance

  • Experimental Controls:

    • Negative controls (non-interacting proteins, IgG controls)

    • Positive controls (known interaction partners)

    • Input controls for all pull-down experiments

    • Cell lines with ATG16L1/ATG9A knockdown as specificity controls

This comprehensive approach provides robust evidence for TMEM74 interactions with ATG16L1/ATG9A while minimizing artifacts and false positives .

How does TMEM74-induced autophagy differ from canonical autophagy pathways?

TMEM74-induced autophagy represents a distinct autophagy pathway with several key differences from canonical autophagy:

  • Initiation Mechanism:

    • Canonical autophagy: Requires the ULK1 complex activation, typically following mTOR inhibition or AMPK activation

    • TMEM74-induced autophagy: Independent of ULK1, suggesting a bypass of this initial regulatory step

  • Nucleation Complex Requirements:

    • Canonical autophagy: Depends on the BECN1/PI3KC3 complex for phagophore formation

    • TMEM74-induced autophagy: Operates independently of the BECN1/PI3KC3 complex

  • Direct Interaction Partners:

    • Canonical autophagy: Involves a sequential cascade of protein complexes

    • TMEM74-induced autophagy: Directly interacts with ATG16L1 (nucleation) and ATG9A (elongation)

  • Regulatory Feedback:

    • Canonical autophagy: Regulated by nutrient sensing and stress response pathways

    • TMEM74-induced autophagy: Features a unique self-regulatory loop where TMEM74 itself can be downregulated through the autophagic process it induces

  • Functional Outcomes:

    • Canonical autophagy: Context-dependent effects on cell survival/death

    • TMEM74-induced autophagy: Predominantly promotes tumor cell survival, particularly under metabolic stress

This unique mechanism of TMEM74-induced autophagy represents an alternative pathway for autophagy activation that operates through direct engagement with core autophagy machinery rather than through conventional regulatory pathways . Understanding these differences is crucial for developing targeted approaches to modulate specific autophagy pathways in disease contexts.

What are the implications of TMEM74's dual role in different cancer contexts?

TMEM74 exhibits context-dependent roles in cancer, with significant implications for cancer biology and therapeutic approaches:

  • Oncogenic Role in Multiple Cancers:

    • High TMEM74 expression correlates with poor prognosis in several cancer types

    • TMEM74-induced autophagy provides a pro-survival mechanism for tumor cells, particularly under metabolic stress

    • Clinical database analysis shows that high TMEM74 expression significantly shortens patient survival in multiple cancer types

  • Potential Protective Role in TNBC:

    • In triple-negative breast cancer (TNBC), TMEM74 appears to play a protective role, contrasting with its oncogenic function in other cancers

    • This protective effect might be due to the specific genetic and molecular context of TNBC

    • The inclusion of TMEM74 in a prognostic model for TNBC suggests its clinical relevance in this context

  • Therapeutic Implications:

    • Cancer-specific targeting: Different therapeutic approaches may be needed for different cancer types based on TMEM74's role

    • Biomarker potential: TMEM74 expression could serve as a prognostic biomarker and guide treatment decisions

    • Resistance mechanisms: TMEM74-induced autophagy might contribute to therapy resistance through its pro-survival effects

  • Research Directions:

    • Understanding the molecular determinants of TMEM74's context-dependent functions

    • Identifying cofactors that influence TMEM74's role in different cancer types

    • Developing cancer-specific strategies to target TMEM74 or its downstream pathways

This dual role underscores the complexity of autophagy regulation in cancer and highlights the importance of context-specific research when developing autophagy-targeting therapeutic strategies .

How can I design experiments to resolve contradictory findings about TMEM74 function across different studies?

To resolve contradictory findings about TMEM74 function across different studies, implement a systematic experimental approach:

  • Standardized Experimental Framework:

    • Reagent validation: Authenticate all TMEM74 antibodies, recombinant proteins, and expression constructs

    • Protocol harmonization: Use standardized protocols for key assays (autophagy, cell survival, interaction studies)

    • Cell line verification: Authenticate and profile all cell lines used to ensure identity and relevant pathway integrity

  • Comprehensive Contextual Analysis:

    • Cross-cancer comparison: Simultaneously test TMEM74 function in multiple cancer types under identical conditions

    • Genetic background analysis: Profile key autophagy and survival pathways in each model system

    • Microenvironment factors: Assess TMEM74 function under various stress conditions (nutrient deprivation, hypoxia, drug treatments)

  • Mechanistic Dissection:

    • Domain-specific function: Test if different domains of TMEM74 mediate different functions

    • Interaction network mapping: Compare TMEM74 protein-protein interactions across different contexts

    • Signaling pathway analysis: Profile downstream signaling activated by TMEM74 in different contexts

  • Advanced Technical Approaches:

    • CRISPR-based screens: Identify genetic modifiers of TMEM74 function

    • Single-cell analysis: Assess heterogeneity in TMEM74 function within populations

    • Multi-omics integration: Combine transcriptomics, proteomics, and metabolomics to create comprehensive functional profiles

  • Validation Strategy:

    • Independent laboratory replication: Collaborate with independent groups to verify key findings

    • In vivo validation: Test critical hypotheses in appropriate animal models

    • Clinical correlation: Analyze patient data to support experimental findings

This systematic approach addresses potential sources of discrepancy while providing a comprehensive framework for understanding context-dependent TMEM74 functions . By explicitly testing contradictory hypotheses under controlled conditions, researchers can resolve inconsistencies and develop a unified model of TMEM74 function.

What is the relationship between TMEM74 expression and cancer patient prognosis?

The relationship between TMEM74 expression and cancer patient prognosis shows significant clinical relevance:

  • Prognostic Correlation in Multiple Cancers:

    • Clinical database analysis demonstrates that high TMEM74 expression significantly shortens survival periods in several specific cancer types

    • TMEM74 has been characterized as an oncogene in various cancers including liver cancer, lung cancer, breast cancer, colon cancer, cervical cancer, and hepatic carcinoma

    • This prognostic correlation is consistent with the pro-survival effect of TMEM74-induced autophagy in tumor cells

  • Cancer-Type Specific Variations:

    • In triple-negative breast cancer (TNBC), TMEM74 is included in a six-gene autophagy-related risk prediction model alongside CDKN1A, CTSD, CTSL, EIF4EBP1, and VAMP3

    • The TNBC risk model demonstrates that TMEM74 might play a protective role in this specific cancer type, contrasting with its oncogenic role in other cancers

    • This variation highlights the context-dependent nature of TMEM74's function and its complex relationship with patient outcomes

  • Mechanistic Basis for Prognostic Impact:

    • TMEM74-triggered autophagy induces a pro-survival effect on tumor cells, particularly under metabolic stress conditions

    • This survival advantage likely contributes to tumor progression, metastasis, and therapy resistance

    • The self-regulatory loop where TMEM74 can be downregulated through autophagy suggests a dynamic regulation of its expression in tumors

These findings collectively establish TMEM74 as an important prognostic factor in cancer, with potential applications in patient stratification and as a therapeutic target .

What methodological approaches can evaluate TMEM74 as a potential therapeutic target?

To comprehensively evaluate TMEM74 as a potential therapeutic target, researchers should implement the following methodological approaches:

  • Target Validation Studies:

    • Genetic Manipulation:

      • CRISPR/Cas9 knockout or knockdown of TMEM74 in cancer cell lines

      • Inducible expression systems to control TMEM74 levels

      • Domain-specific mutations to identify critical functional regions

    • Phenotypic Assessment:

      • Cell proliferation, migration, invasion assays

      • Tumor sphere formation for cancer stem cell properties

      • Drug resistance profiling with and without TMEM74 modulation

  • Therapeutic Modality Screening:

    • Small Molecule Inhibitors:

      • High-throughput screening of compound libraries

      • Structure-based drug design (if structural data available)

      • Repurposing screens of approved drugs

    • Biologics Approach:

      • Neutralizing antibodies against TMEM74

      • Peptide inhibitors targeting interaction interfaces

      • siRNA/antisense oligonucleotides for expression inhibition

  • Preclinical Efficacy Models:

    • In Vitro Models:

      • 2D and 3D culture systems

      • Patient-derived organoids

      • Co-culture systems with tumor microenvironment components

    • In Vivo Models:

      • Xenograft models with TMEM74 modulation

      • Genetically engineered mouse models

      • Patient-derived xenografts for translational relevance

  • Biomarker Development:

    • Expression Analysis:

      • IHC protocols for TMEM74 detection in tissue samples

      • Gene expression signatures associated with TMEM74 activity

      • Circulating biomarkers that correlate with tumor TMEM74 status

    • Response Prediction:

      • Identification of molecular features predicting response to TMEM74 targeting

      • Development of companion diagnostic approaches

  • Combination Strategy Assessment:

    • TMEM74 inhibition combined with conventional therapies

    • TMEM74 targeting with other autophagy modulators

    • Synthetic lethality screens to identify potent combinations

This comprehensive evaluation framework provides the necessary evidence to determine TMEM74's viability as a therapeutic target while accounting for context-dependent effects and potential resistance mechanisms .

How can researchers develop experimental tools to study the unique autophagy pathway mediated by TMEM74?

To study the unique autophagy pathway mediated by TMEM74, researchers should develop specialized experimental tools:

  • Pathway-Specific Probes and Reporters:

    • TMEM74-specific interaction biosensors:

      • FRET/BRET-based sensors to detect TMEM74-ATG16L1 and TMEM74-ATG9A interactions in real-time

      • Split-fluorescent protein complementation systems for visualizing interactions in live cells

    • Specialized autophagy flux reporters:

      • Modified tandem fluorescent-tagged LC3 reporters optimized for TMEM74-induced autophagy

      • Pathway-specific substrate degradation sensors

  • Genetic and Molecular Tools:

    • Domain-specific TMEM74 mutants:

      • Truncation libraries to map functional domains

      • Point mutations at key interaction interfaces

      • Chimeric constructs with domains from related proteins

    • Inducible expression systems:

      • Tet-On/Off systems for temporal control of TMEM74 expression

      • Optogenetic control of TMEM74 activity

      • Chemical-induced degradation systems for rapid TMEM74 depletion

  • Biochemical and Structural Analysis Tools:

    • Purification systems for TMEM74 complexes:

      • Tandem affinity purification tags optimized for membrane protein complexes

      • Nanobodies specific to native TMEM74 conformations

    • Structural biology approaches:

      • Cryo-EM methods adapted for TMEM74-containing complexes

      • Crosslinking mass spectrometry workflows for interaction mapping

  • Pathway-Selective Inhibitors and Activators:

    • TMEM74-specific blocking peptides/antibodies:

      • Peptides derived from ATG16L1/ATG9A binding regions

      • Single-domain antibodies targeting functional epitopes

    • Small molecule modulators:

      • Compound screens with readouts specific to TMEM74-induced autophagy

      • Structure-activity relationship studies of hit compounds

  • Advanced Cellular Models:

    • Reconstituted systems:

      • Cell lines with endogenous autophagy components knocked out and replaced with trackable versions

      • Minimal systems reconstituting TMEM74-dependent autophagy

    • Patient-derived models:

      • Primary cell cultures with varying TMEM74 expression levels

      • Organoids representing different disease contexts

These specialized tools will enable researchers to dissect the unique mechanisms of TMEM74-mediated autophagy, distinguish it from canonical pathways, and develop targeted interventions for therapeutic applications .

What are the most promising avenues for advancing our understanding of TMEM74 biology?

The most promising research avenues for advancing TMEM74 biology include:

  • Structural Biology Approaches:

    • Determine the three-dimensional structure of TMEM74 alone and in complex with ATG16L1/ATG9A

    • Characterize conformational changes associated with TMEM74 activation

    • Develop structure-based models of TMEM74's membrane topology and organization

  • Systems Biology Integration:

    • Map the complete TMEM74 interactome across different cellular contexts

    • Identify regulatory networks controlling TMEM74 expression and activity

    • Develop computational models of TMEM74-mediated autophagy dynamics

  • Cancer Context Specificity:

    • Investigate the molecular basis for TMEM74's contrasting roles in different cancer types

    • Identify genetic or epigenetic modifiers that determine TMEM74's function

    • Develop predictive biomarkers for TMEM74 dependency in tumors

  • Non-Autophagy Functions:

    • Explore potential autophagy-independent functions of TMEM74

    • Investigate TMEM74's role in other cellular processes such as metabolism or inflammation

    • Characterize TMEM74 functions in non-cancer contexts and normal physiology

  • Therapeutic Development:

    • Design and screen for selective TMEM74 inhibitors based on interaction interfaces

    • Develop approaches to modulate TMEM74 expression in a tissue-specific manner

    • Identify synthetic lethal interactions that could be exploited therapeutically

These research directions would significantly expand our understanding of TMEM74 biology while addressing critical gaps in knowledge about its structure, regulation, context-dependent functions, and therapeutic potential .

How can researchers address challenges in studying transmembrane proteins like TMEM74?

Researchers can address challenges in studying transmembrane proteins like TMEM74 through specialized approaches:

  • Expression and Purification Optimization:

    • Expression Systems:

      • Use specialized hosts designed for membrane proteins (C41/C43 E. coli strains, Pichia pastoris)

      • Implement mammalian expression systems that maintain native folding and modifications

      • Consider cell-free expression systems for difficult-to-express proteins

    • Solubilization Strategies:

      • Screen multiple detergents and lipid-like surfactants

      • Employ nanodiscs or lipid bilayer mimetics for native-like environments

      • Use fusion partners specifically designed for membrane proteins (e.g., MISTIC, GFP)

  • Structural Analysis Adaptations:

    • Cryo-EM Approaches:

      • Focus on single-particle analysis optimized for smaller membrane proteins

      • Implement lipid nanodisc reconstitution for structure determination

    • Integrative Structural Biology:

      • Combine limited proteolysis, hydrogen-deuterium exchange, and crosslinking mass spectrometry

      • Use computational modeling informed by experimental constraints

    • Specialized NMR Techniques:

      • Solid-state NMR approaches for membrane-embedded portions

      • Solution NMR for soluble domains with selective isotope labeling

  • Functional Characterization Methods:

    • Membrane Topology Mapping:

      • Accessibility labeling to determine transmembrane orientation

      • Substituted cysteine accessibility method (SCAM)

      • Split reporter assays for domain localization

    • Live Cell Imaging Adaptations:

      • Super-resolution microscopy optimized for membrane proteins

      • Single-molecule tracking to analyze dynamics and interaction kinetics

      • Correlative light and electron microscopy for ultrastructural context

  • Genetic and Biochemical Tools:

    • CRISPR Knock-in Strategies:

      • Tag endogenous TMEM74 with minimal interference to function

      • Develop domain-specific antibodies with epitopes verified by genetic approaches

    • Proximity Labeling Methods:

      • TurboID or APEX2 fusion proteins for in situ interactome analysis

      • Spatially resolved protein interaction mapping in membrane microdomains

These specialized approaches can overcome the inherent challenges of studying transmembrane proteins like TMEM74, enabling more comprehensive characterization of their structure, function, and interactions .

What experimental approaches could reveal the evolutionary significance of TMEM74's unique autophagy pathway?

To investigate the evolutionary significance of TMEM74's unique autophagy pathway, researchers can employ the following experimental approaches:

  • Comparative Genomics and Phylogenetics:

    • Cross-species TMEM74 analysis:

      • Identify TMEM74 orthologs across diverse species using sequence and structural homology

      • Reconstruct the evolutionary history of the TMEM74 gene family

      • Compare domain organization and conservation patterns of functional regions

    • Pathway evolution mapping:

      • Track the co-evolution of TMEM74 with its binding partners ATG16L1 and ATG9A

      • Identify evolutionary branch points where conventional and TMEM74-mediated autophagy diverged

      • Analyze selection pressures on different autophagy pathways

  • Functional Conservation Studies:

    • Cross-species functional assays:

      • Test TMEM74 orthologs from different species for autophagy induction

      • Perform complementation experiments in TMEM74-knockout systems

      • Create chimeric proteins mixing domains from different species to map functional conservation

    • Model organism approaches:

      • Generate TMEM74-equivalent mutants in evolutionary distant model organisms

      • Compare phenotypic outcomes across species

      • Analyze tissue-specific functions in different evolutionary lineages

  • Structural Biology with Evolutionary Perspective:

    • Ancestral sequence reconstruction:

      • Computationally infer ancestral TMEM74 sequences

      • Express and characterize ancestral TMEM74 proteins

      • Compare binding properties and functions with modern TMEM74

    • Evolutionary structural analysis:

      • Map conserved and divergent regions onto protein structures

      • Identify structural innovations associated with functional specialization

      • Model the evolution of protein-protein interaction interfaces

  • Systems-Level Evolutionary Analysis:

    • Autophagy network comparisons:

      • Compare complete autophagy networks across species with and without TMEM74

      • Identify compensatory mechanisms in species lacking TMEM74

      • Map the integration of TMEM74 into existing autophagy regulatory networks

    • Contextual adaptation analysis:

      • Investigate correlation between TMEM74 presence and specific ecological or physiological adaptations

      • Analyze tissue-specific expression patterns across evolutionary lineages

      • Examine TMEM74 function in the context of species-specific metabolic requirements

These approaches would provide insights into when and why this alternative autophagy pathway evolved, its adaptive significance, and the molecular mechanisms underlying its functional specialization .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.