Recombinant Mouse Transmembrane protein 79 (Tmem79)

Shipped with Ice Packs
In Stock

Description

Definition and Production

Recombinant Mouse Tmem79 is a 391-amino acid protein (UniProt ID: Q9D709) expressed in E. coli with an N-terminal 10xHis tag for purification . Its sequence includes transmembrane domains (residues 178–198, 221–241, 260–280, 299–319, and 338–358) and functional motifs critical for interactions with signaling receptors like Frizzled (FZD) .

Mechanistic Roles in Wnt/FZD Signaling

Tmem79 regulates Wnt signaling by promoting lysosomal degradation of FZD receptors during biogenesis. This occurs via:

  • USP8 Inhibition: Tmem79 binds ubiquitin-specific protease 8 (USP8), blocking its deubiquitination of FZD and enabling FZD ubiquitination for lysosomal targeting .

  • ER-Lysosome Trafficking: Unlike ZNRF3/RNF43-mediated PM FZD degradation, Tmem79 acts in the endoplasmic reticulum (ER), directing immature FZD to lysosomes .

Comparative Pathways for FZD Regulation

Pathway ComponentTMEM79-Mediated DegradationZNRF3/RNF43-Mediated Degradation
LocationERPlasma Membrane (PM)
Key PartnersUSP8R-spondin (Rspo)
Ubiquitination SiteImmature FZDMature FZD
Inhibition RescueUSP8 depletionRspo addition

Developmental Biology

  • Neural Patterning: In Xenopus, Tmem79 depletion disrupts anterior neural plate formation and neural crest development, rescued by β-catenin or USP8 co-depletion .

  • Gastrulation: Axial mesoderm-specific Tmem79 loss impairs convergent extension movements via FZD/planar cell polarity (PCP) signaling .

Dermatology

  • Skin Barrier Function: Tmem79 knockout mice exhibit atopic dermatitis (AD)-like symptoms due to dysregulated keratinocyte differentiation and elevated Wnt/β-catenin signaling .

  • TRPV3 Modulation: Tmem79 traps TRPV3 ion channels in the ER, promoting lysosomal degradation and altering thermal sensitivity in keratinocytes .

Key Studies

  1. CRISPR/Cas9 Screening

    • TMEM79 knockout HEK293T cells showed elevated FZD5 levels and Wnt pathway activation comparable to ZNRF3/RNF43 double knockouts .

    • Rescue experiments confirmed TMEM79 and ZNRF3 act in parallel pathways .

  2. Xenopus Embryogenesis

    • Tmem79 morpholino knockdown caused:

      • 50% anterior patterning defects (rescued by β-catenin/USP8 co-depletion).

      • Loss of neural crest markers (Foxd3, Snail1) and melanocyte deficiency .

  3. Thermal Response

    • TMEM79-KO mice exhibited heightened warmth sensitivity due to TRPV3 accumulation .

Therapeutic Implications

Tmem79 is implicated in:

  • Atopic Dermatitis: Dysregulation correlates with FZD/Wnt signaling anomalies in keratinocytes .

  • Neural Crest Disorders: Potential link to melanocyte deficiencies and neurocristopathies .

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you require a specific format, please indicate your preference in the order notes. We will prepare accordingly.
Lead Time
Delivery time may vary depending on the purchasing method and location. For specific delivery timelines, please consult your local distributors.
Note: Our proteins are typically shipped with standard blue ice packs. If dry ice shipment is required, please contact us in advance as additional fees will apply.
Notes
Repeated freeze-thaw cycles are not recommended. For optimal usage, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and protein stability.
Generally, liquid form has a shelf life of 6 months at -20°C/-80°C, while lyophilized form has a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
If you have a specific tag type requirement, please inform us, and we will prioritize the development of your preferred tag.
Synonyms
Tmem79; Matt; Transmembrane protein 79; Mattrin
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-391
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Tmem79
Target Protein Sequence
MTEPETLALLDMKEPETPEKSPPQALVLQSEEEGGTESPGTESLRVGSSVGSPIVREGPE DGPDSTISEAATLPWGTDPHPSAPLPDPPGWRDIEPEPLESEAPTKSEEPFKEDANLLPE KTVRAFVPIDLQCIERKPQEERILHRDAGPGELRNFLPARLSHPEPPERKWAEAVVRPPG RSCGGCGSCGGREALRAVASVVAALIFFPCLLYGAYAFLPFDAPRLPTMSSRLVYTLRCG VFATFPIVLGLLVYGLSLLCFSALRPFGEPRREVEIHRQYVAQSVQLFILYFFNLAVLST YLPQDTLKLLPLLTGLFAISRLIYWLTFAVGRSFRGFGYGLTFLPLLAMLVWNLYYMFVV EPERMLTASESRLDYPDHARSVSDYRPRSWG
Uniprot No.

Target Background

Function
Tmem79 contributes to the epidermal integrity and skin barrier function. It plays a crucial role in the lamellar granule (LG) secretory system and the formation of the stratum corneum (SC) epithelial cells.
Gene References Into Functions
  1. The Tmem79 (ma/ma) mutation is responsible for the spontaneous dermatitis phenotype in matted mice. This is likely due to impaired lamellar granule secretory system and altered stratum corneum barrier function. PMID: 24060273
Database Links

KEGG: mmu:71913

UniGene: Mm.34256

Involvement In Disease
Defects in Tmem79 are the cause of the spontaneous matted (matt) mutant phenotype, a model for human atopic dermatitis. Atopic dermatitis (ma/ma) mice have a matted hair phenotype with progressive dermatitis-like skin inflammation and a scratching behavior. Mice display an altered skin barrier that facilitates allergic sensitization.
Subcellular Location
Lysosome. Golgi apparatus, trans-Golgi network. Membrane; Multi-pass membrane protein. Note=Colocalized with TGOLN2 in the trans-Golgi network. Colocalized with LAMP1 in the lysosome.
Tissue Specificity
Expressed in the epidermis of the skin. Expressed in epithelial cells of the outermost layer of the stratum granulosum (SG) and in hair follicles (at protein level).

Q&A

What is Tmem79 and what are its basic cellular functions?

Tmem79 (also known as MATTRIN) is an orphan transmembrane protein linked to atopic dermatitis (AD) in both mice and humans. It is expressed in multiple cell types, most notably keratinocytes and sensory neurons . Structurally, Tmem79 has limited sequence homology to a family of microsomal glutathione transferases, suggesting a potential role in regulating oxidative stress by conferring protection from cellular accumulation of damaging reactive species .

At the molecular level, Tmem79 functions in multiple pathways. It serves as a negative regulator of Wnt signaling by interacting with Frizzled (FZD) receptors and promoting their degradation . Additionally, Tmem79 has been found to regulate TRPV3 activity through direct protein-protein interactions . These diverse functions position Tmem79 at the intersection of several important cellular processes, including skin barrier maintenance, Wnt signaling, and sensory neuron function.

How is Tmem79 related to atopic dermatitis?

Tmem79 has been identified as a predisposition gene for atopic dermatitis. The "matted" mouse mutant, which carries a mutation in the Tmem79 gene, exhibits spontaneous development of AD-like symptoms, making it an important animal model for studying this disease .

In mice lacking Tmem79 function, there is a clear phenotype characterized by relapsing inflammation, skin-barrier defects, and intractable itch . Specifically, loss of keratinocytic Tmem79 is sufficient to elicit robust scratching behavior, which is a hallmark of AD-related discomfort . These mice also demonstrate an accumulation of dermal mast cells, which contribute to the inflammatory and pruritic aspects of the condition .

The association between Tmem79 and AD extends to humans as well. Single nucleotide polymorphisms (SNPs) in the human TMEM79 gene have been associated with AD in several independent case collections, supporting the clinical relevance of findings from mouse models .

What expression patterns does Tmem79 show across tissues and developmental stages?

Tmem79 shows a dynamic expression pattern that varies both across tissues and during development. In adult tissues, Tmem79 is expressed in both keratinocytes and sensory neurons . This dual expression pattern is significant as it suggests that Tmem79 may have cell-type specific functions in different tissues.

During embryonic development, Tmem79 exhibits dynamic expression patterns, as revealed by spatiotemporal transcriptome analysis in mice . In Xenopus embryos, manipulation of Tmem79 expression affects anterior development, suggesting an important role in early patterning and morphogenesis .

Interestingly, while Tmem79 plays a crucial role in Xenopus development, Tmem79 knockout mice exhibit overtly normal embryogenesis and are viable, suggesting possible redundancy with other proteins during mammalian development . This apparent discrepancy between species highlights the complexity of developmental regulation and the potential for compensatory mechanisms.

What are the recommended methods for detecting Tmem79 expression in tissues?

For detecting Tmem79 expression in tissue samples, researchers can employ several complementary approaches:

  • RNA Detection: Semiquantitative RT-PCR has been successfully used to detect Tmem79 transcripts. An intron-spanning amplification across exons 3 and 4 provides specific detection of Tmem79 mRNA. Using Krt14 as a loading control can help normalize results . RNA extraction from mouse tissue samples can be performed using standard methods such as the RNeasy kit following tissue homogenization.

  • Protein Detection: For protein-level detection, western blotting using specific antibodies against Tmem79 can be employed. This approach has been used to distinguish between wild-type and mutant forms of the protein .

  • Genotyping: For mouse models, genotyping can be performed by PCR amplification of the third Tmem79 exon (generating a 644-bp product) followed by digestion with the restriction enzyme CviQI. The resulting fragments can be separated and visualized via agarose gel electrophoresis .

  • Cellular Localization: Immunohistochemistry or immunofluorescence using specific antibodies can help determine the subcellular localization of Tmem79. Research has shown that unlike some of its interacting partners (e.g., ZNRF3), Tmem79 may not be primarily localized at the plasma membrane but rather at intracellular compartments such as the ER .

How can researchers generate and validate Tmem79 knockout models?

Generating and validating Tmem79 knockout models requires careful attention to several key aspects:

  • Knockout Strategy: CRISPR-Cas9 technology has been successfully employed to generate Tmem79 knockout (T79KO) cell lines and animal models . When designing guide RNAs, targeting conserved regions in exons that would disrupt protein function is recommended.

  • Validation of Knockout:

    • Genomic Validation: Sequencing the targeted region to confirm mutation introduction.

    • Transcript Validation: RT-PCR to confirm absence or alteration of the Tmem79 transcript.

    • Protein Validation: Western blotting to confirm absence of the Tmem79 protein.

    • Functional Validation: Assessing known Tmem79-dependent phenotypes, such as enhanced Wnt signaling activity using the TOP-Flash reporter assay in cell culture .

  • Phenotypic Characterization: T79KO mouse models should be assessed for:

    • Skin barrier function and development of AD-like symptoms

    • Inflammatory markers and mast cell accumulation

    • Scratching behavior as an indication of itch

    • Wnt signaling activity in relevant tissues

    • Temperature sensitivity due to TRPV3 regulation

  • Controls: Using littermate controls is crucial for minimizing genetic background effects. Additionally, rescue experiments by reintroducing wild-type Tmem79 provide strong validation of phenotype specificity .

What are effective approaches for studying Tmem79 protein interactions?

Studying Tmem79 protein interactions requires a combination of biochemical, cellular, and functional approaches:

  • Co-immunoprecipitation (Co-IP): This has been successfully used to demonstrate Tmem79 interactions with:

    • Frizzled (FZD) family proteins: Tmem79 co-IPs with all ten FZD proteins (FZD1-10) but not with the related Smoothened (SMO) receptor

    • TRPV3 channels: Physical interaction detected through Co-IP experiments

    When performing Co-IP experiments, it's important to note that Tmem79 preferentially interacts with immature/unglycosylated forms of FZD proteins at the ER rather than mature forms at the plasma membrane .

  • Cell Surface Biotinylation: This technique helps distinguish between plasma membrane-localized and intracellular proteins. Research has shown that Tmem79 itself is not readily surface-biotinylated, suggesting it may primarily function intracellularly .

  • Functional Assays:

    • Wnt Signaling: TOP-Flash luciferase reporter assays can measure the functional impact of Tmem79 on Wnt/β-catenin signaling

    • TRPV3 Activity: Electrophysiological experiments using whole-cell patch-clamp methods in cells expressing TRPV3 with or without Tmem79 can assess the functional interaction between these proteins

  • Domain Mapping: Creating truncation or point mutants of Tmem79 can help identify specific regions required for protein interactions and function.

How does Tmem79 regulate the Wnt/Frizzled signaling pathway?

Tmem79 functions as a negative regulator of Wnt/Frizzled signaling through several mechanisms:

  • FZD Protein Regulation: Tmem79 promotes the degradation of Frizzled (FZD) receptors, which are essential for Wnt signal transduction. It interacts specifically with all ten FZD family proteins but not with the related Smoothened (SMO) receptor .

  • Interaction with Immature FZD: Unlike other FZD regulators such as ZNRF3, Tmem79 preferentially interacts with immature/unglycosylated FZD proteins at the endoplasmic reticulum (ER) rather than mature forms at the plasma membrane. This suggests that Tmem79 regulates FZD during its biogenesis and trafficking .

  • Reduction of Cell Surface FZD: Despite primarily interacting with immature FZD, Tmem79 overexpression reduces mature FZD levels at the plasma membrane, similar to ZNRF3. This indicates that Tmem79's ER-level regulation affects the ultimate surface expression of FZD receptors .

  • Ubiquitination-Dependent Mechanism: The FZD5-K0 mutant (with cytoplasmic lysine residues replaced by arginine) is resistant to Tmem79-mediated downregulation, suggesting that Tmem79's effect involves ubiquitination of FZD proteins .

  • Independent Pathway from ZNRF3/RNF43: Although ZNRF3/RNF43 are also negative regulators of FZD, Tmem79 functions independently of them. This is evidenced by:

    • Tmem79 can antagonize Wnt signaling in ZNRF3/RNF43 knockout cells

    • ZNRF3 can antagonize Wnt signaling in Tmem79 knockout cells

    • Combined depletion of both Tmem79 and ZNRF3 has additive effects on Wnt pathway activation

This independence suggests two parallel pathways for FZD regulation: Tmem79 at the ER level and ZNRF3/RNF43 at the plasma membrane level.

What is the relationship between Tmem79 and mast cell function in atopic dermatitis?

Tmem79 plays a crucial role in regulating mast cell accumulation and function in the context of atopic dermatitis:

  • Mast Cell Accumulation: Mice lacking functional Tmem79 (Tmem79-/- mice) demonstrate a significant accumulation of dermal mast cells, suggesting that Tmem79 normally restricts mast cell numbers in the skin .

  • Prostaglandin E2 (PGE2) Involvement: The mast cell accumulation in Tmem79-/- mice can be diminished by chronic treatment with cyclooxygenase inhibitors and an EP3 receptor antagonist, indicating that PGE2 signaling through the EP3 receptor contributes to this phenotype .

  • Histaminergic Itch Mechanism: In Tmem79-/- mice, mast cell degranulation produces histamine-dependent itch. This itch response involves both histamine receptor 1 (H1R) and histamine receptor 4 (H4R), suggesting multiple histamine signaling pathways contribute to the pruritus in this model .

  • TRPV1-Afferent Activation: The histaminergic itch in Tmem79-deficient mice may involve activation of TRPV1-expressing sensory afferents, linking mast cell function to neural circuit activation and perception of itch .

  • Oxidative Stress Connection: Tmem79 has homology to microsomal glutathione transferases and may protect cells from accumulating damaging reactive species. This suggests a potential link between oxidative stress, mast cell activation, and the development of AD symptoms in Tmem79-deficient conditions .

These findings indicate that Tmem79 regulates mast cell numbers and activity through both direct and indirect mechanisms, and the dysregulation of these processes in Tmem79 deficiency contributes significantly to the AD phenotype.

How does Tmem79 interact with TRPV3 and affect temperature sensation?

Tmem79 has been identified as a regulator of TRPV3, a temperature-sensitive ion channel expressed in skin keratinocytes:

  • Direct Protein Interaction: Tmem79 physically interacts with TRPV3 through protein-protein interactions, as demonstrated in co-immunoprecipitation experiments .

  • Negative Regulation: Tmem79 functions as a negative regulator of TRPV3-mediated activities. This regulatory role has been confirmed through both overexpression and knockout studies .

  • Temperature Sensing Impact: TRPV3 is known to be activated by warm temperatures (>33°C). Tmem79's regulation of TRPV3 affects temperature detection in the skin. Specifically, Tmem79-knockout mice show altered responses to temperature stimuli, suggesting enhanced TRPV3 activity in the absence of Tmem79's inhibitory effect .

  • Potential Mechanisms: While the exact mechanism of TRPV3 regulation by Tmem79 is not fully elucidated in the provided search results, several possibilities exist:

    • Tmem79 might affect TRPV3 trafficking to the cell surface

    • It could alter TRPV3 channel properties through allosteric modulation

    • It might influence TRPV3 stability or turnover

  • Relevance to Skin Conditions: Given TRPV3's role in keratinocyte function and skin barrier maintenance, the Tmem79-TRPV3 interaction may contribute to the skin phenotypes observed in Tmem79-deficient conditions, including atopic dermatitis .

This connection between Tmem79 and TRPV3 adds another layer to understanding how Tmem79 influences skin physiology and sensory function, beyond its roles in Wnt signaling and mast cell regulation.

What therapeutic strategies target Tmem79-related pathways in atopic dermatitis?

Based on the mechanistic understanding of Tmem79's role in atopic dermatitis, several therapeutic approaches could be effective:

  • Targeting PGE2 Signaling: Research has shown that chronic treatment with cyclooxygenase inhibitors and EP3 receptor antagonists can diminish the accumulation of dermal mast cells in Tmem79-deficient mice . This suggests that non-steroidal anti-inflammatory drugs (NSAIDs) that inhibit cyclooxygenase or specific EP3 receptor antagonists might be beneficial in treating Tmem79-related AD.

  • Antihistamine Combination Therapy: In Tmem79-deficient mice, mast cell degranulation produces histaminergic itch in a histamine receptor 1/histamine receptor 4 (H1R/H4R)-dependent manner . This suggests that combination therapy targeting both H1R and H4R might be more effective than conventional H1R antagonists alone for treating the itch associated with Tmem79-related AD.

  • TRPV1-Targeted Interventions: The histaminergic itch in Tmem79-deficient mice may involve activation of TRPV1-expressing afferents . Thus, TRPV1 antagonists might help alleviate the itch symptoms in affected individuals.

  • Antioxidant Therapies: Given Tmem79's homology to microsomal glutathione transferases and its potential role in regulating oxidative stress, antioxidant therapies might address the underlying pathophysiology of Tmem79-related AD .

  • Wnt Pathway Modulation: Since Tmem79 regulates Wnt/Frizzled signaling, which appears to be deregulated in AD, therapeutic approaches targeting this pathway could potentially address some aspects of the disease .

The multifaceted role of Tmem79 suggests that combination therapies addressing multiple affected pathways might provide the most effective approach for treating Tmem79-related atopic dermatitis.

How do Tmem79 mutations in humans correlate with atopic dermatitis phenotypes?

The correlation between human Tmem79 mutations and atopic dermatitis phenotypes represents an important area of clinical research:

  • Genetic Association: Single nucleotide polymorphisms (SNPs) in the human TMEM79 gene have been associated with atopic dermatitis in multiple independently recruited AD case collections . This suggests that TMEM79 is a predisposition gene for AD in humans, similar to its role in mice.

  • Phenotypic Spectrum: While specific phenotypic details of human TMEM79 mutations are not extensively described in the provided search results, the mouse models suggest that TMEM79 deficiency likely contributes to skin barrier dysfunction, inflammatory responses, and pruritus in affected individuals .

  • Potential Interaction with Filaggrin: Research on the flaky tail mouse, which carries both a filaggrin mutation and the matted (Tmem79) mutation, has provided insights into how multiple genetic factors may interact to affect AD risk and severity . This suggests that in humans, the phenotypic expression of TMEM79 mutations might be influenced by the status of other AD-related genes, particularly FLG (filaggrin).

  • Therapeutic Implications: Understanding the specific phenotypes associated with TMEM79 mutations could help guide personalized therapeutic approaches for affected individuals. For example, patients with TMEM79 mutations might particularly benefit from therapies targeting histaminergic pathways or PGE2 signaling, based on the mechanistic insights from mouse models .

  • Biomarker Potential: Characterization of TMEM79 mutation-associated phenotypes could lead to the identification of specific biomarkers that might be useful for diagnosis, prognosis, or monitoring treatment response in AD patients.

Further clinical research correlating specific TMEM79 variants with detailed phenotypic characteristics in human AD patients would enhance our understanding of this genetic factor's contribution to disease heterogeneity.

What are the species-specific differences in Tmem79 function across model organisms?

Research indicates significant species-specific differences in Tmem79 function, particularly between amphibian and mammalian models:

  • Developmental Role Discrepancies:

    • In Xenopus (frog) embryos, Tmem79 plays a crucial role in anterior development. Depletion of Tmem79 from the animal region/naive ectoderm results in deficiency in anterior development and anterior gene expression, which can be rescued by mouse Tmem79 mRNA .

    • In contrast, Tmem79 knockout mice exhibit overtly normal embryogenesis and are viable, suggesting that Tmem79 may have a non-essential or redundant role during mouse embryonic development .

  • Potential Explanations for These Differences:

    • Maternal Wnt influence: Significant maternal Wnt expression in Xenopus eggs may persist in early embryos, requiring multiple Wnt antagonists (including Tmem79) to counter this influence for normal embryogenesis. In mice, maternal Wnt influence may be more limited, making the requirement for individual Wnt antagonists less stringent .

    • Genetic compensation: Genetic deletion in mice may trigger compensatory mechanisms that don't occur during acute knockdowns via antisense morpholino techniques used in Xenopus studies .

    • Evolutionary divergence in developmental pathways: Despite these apparent differences, the underlying mechanism of Wnt regulation in developmental processes is likely conserved across species .

  • Functional Conservation: Despite developmental differences, the molecular function of Tmem79 as a negative regulator of Wnt signaling through FZD regulation appears to be conserved between frogs and mammals .

  • Implications for Research: These species-specific differences highlight the importance of using multiple model organisms to fully understand Tmem79 function. Findings from one model may not always directly translate to another, necessitating careful validation across species.

How does Tmem79 interact with parallel pathways regulating skin barrier function?

Tmem79 operates within a complex network of pathways regulating skin barrier function, with several important interactions:

  • Relationship with Filaggrin Pathway: Tmem79 (the matted gene) was initially identified in flaky tail mice, which also carry a mutation in the filaggrin gene (Flg) . Filaggrin is a key protein for skin barrier function, and mutations in FLG are the strongest known genetic risk factor for atopic dermatitis in humans. The co-occurrence of these mutations suggests potential functional interactions between their respective pathways.

  • Wnt Signaling in Skin Homeostasis: Tmem79 negatively regulates Wnt/Frizzled signaling , which plays crucial roles in skin development, hair follicle cycling, and epidermal stem cell maintenance. Dysregulation of this pathway due to Tmem79 deficiency may contribute to skin barrier abnormalities through altered keratinocyte differentiation or proliferation.

  • TRPV3 Regulation: Tmem79 interacts with and regulates TRPV3 , a temperature-sensitive ion channel expressed in keratinocytes that influences skin barrier formation, keratinocyte differentiation, and hair growth. The Tmem79-TRPV3 interaction represents another mechanism through which Tmem79 may influence skin barrier function.

  • Oxidative Stress Management: Tmem79's homology to microsomal glutathione transferases suggests a role in protecting cells from oxidative stress . Oxidative stress can damage lipids, proteins, and DNA in the skin, compromising barrier function. Tmem79 may therefore contribute to barrier integrity through redox homeostasis.

  • Inflammatory Pathway Regulation: Tmem79 deficiency leads to mast cell accumulation and inflammatory responses . This inflammatory component can further compromise skin barrier function through various mechanisms, including altered lipid composition and disrupted tight junctions.

The multifaceted nature of Tmem79's interactions highlights the complexity of skin barrier regulation and suggests that therapeutic approaches targeting Tmem79-related pathways may need to address multiple aspects of skin physiology.

What are the remaining knowledge gaps in understanding Tmem79 structure-function relationships?

Despite significant advances in understanding Tmem79 function, several knowledge gaps remain regarding its structure-function relationships:

  • Three-Dimensional Structure: The detailed three-dimensional structure of Tmem79 has not been fully elucidated. Structural information would provide insights into:

    • The topology and arrangement of transmembrane domains

    • Potential binding pockets or interaction surfaces

    • Conformational changes associated with function

    • Structural basis for its homology to microsomal glutathione transferases

  • Functional Domains: The specific domains of Tmem79 responsible for its various functions have not been comprehensively mapped. Questions remain about:

    • Which regions are essential for FZD interaction and regulation

    • Which domains mediate TRPV3 binding and modulation

    • Whether different functions (Wnt regulation, TRPV3 modulation, oxidative stress protection) involve distinct or overlapping domains

  • Post-Translational Modifications: Little is known about potential post-translational modifications of Tmem79 and how they might regulate its function, localization, or stability. Understanding these modifications could reveal additional regulatory mechanisms.

  • Regulatory Mechanisms: How Tmem79 expression and activity are regulated under normal and pathological conditions remains incompletely understood. Factors that might influence Tmem79 include:

    • Transcriptional regulation in different tissues and developmental stages

    • Protein stability and turnover mechanisms

    • Potential regulation through protein-protein interactions

  • Subcellular Trafficking: While there is evidence that Tmem79 may function primarily at intracellular compartments rather than the plasma membrane , detailed understanding of its trafficking, recycling, and compartmentalization is lacking.

  • Molecular Mechanism of FZD Regulation: Although Tmem79 has been shown to promote FZD degradation and requires FZD lysine residues (suggesting ubiquitination) , the precise molecular mechanisms by which it achieves this regulation remain to be fully elucidated.

Addressing these knowledge gaps would enhance our understanding of Tmem79 function and potentially reveal new therapeutic targets for treating Tmem79-related disorders.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.