Recombinant Mouse Transmembrane protein 88 (Tmem88)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your preferred format in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires advance notification and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a reference.
Shelf Life
Shelf life depends on various factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Tmem88; Transmembrane protein 88
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-159
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Tmem88
Target Protein Sequence
MAEVPGAQRPVLAGGPEPRDPLDCWACAVLVTAQNLLVAVFNLLLLALVLGTILLPAVIM LGFGFLCHSQFLRSQAPLCTSHLRDPGFTALLVTGFLLLVPLLVLALATYRRLCLRLRLA DCLVPYSRALYRRRRIPQPKQIPVSPGSRSVPTPGKVWV
Uniprot No.

Target Background

Function
This protein inhibits the Wnt/β-catenin signaling pathway. It plays a crucial role in heart development, acting downstream of GATA factors in the pre-cardiac mesoderm to specify cardiomyocyte lineage commitment.
Database Links
Protein Families
TMEM88 family
Subcellular Location
Cell membrane; Multi-pass membrane protein.

Q&A

What is Transmembrane Protein 88 (TMEM88) and what is its cellular localization?

TMEM88 is a transmembrane protein encoded on human chromosome 17, characterized by its localization to the plasma membrane while also being identified with cytosolic localization in certain contexts . The protein contains a crucial C-terminal VWV (Val-Trp-Val) motif that mediates its interaction with the PDZ domain of Dishevelled (Dvl/Dsh) proteins, key components of the Wnt signaling pathway . In mice, the Tmem88 gene produces a protein with similar structural features that maintains the functional VWV motif necessary for Wnt pathway interaction. TMEM88 is classified as a two-transmembrane-type protein, with both N- and C-terminal domains strategically positioned to facilitate protein-protein interactions that influence signaling cascades .

In experimental settings, researchers have confirmed TMEM88's membrane localization through subcellular fractionation and immunofluorescence microscopy. In Xenopus studies, TMEM88 protein was specifically sublocalized at the cell membrane, which is critical for its function in inhibiting Wnt signaling . This localization pattern is consistent across different experimental models and appears to be essential for TMEM88's role in development and disease contexts.

How does TMEM88 regulate the Wnt signaling pathway?

TMEM88 functions as a negative regulator of the canonical Wnt pathway through its direct interaction with Dishevelled (Dvl/Dsh) proteins . This regulatory mechanism involves:

  • Direct binding of TMEM88's C-terminal VWV motif to the PDZ domain of Dvl proteins

  • Competition with LRP5/6 co-receptors for Dvl binding

  • Recruitment of Dvl to the plasma membrane

  • Inhibition of downstream β-catenin stabilization and nuclear translocation

The interaction between TMEM88 and Dvl has been confirmed through multiple experimental approaches, including NMR spectroscopy and fluorescence spectroscopy . In functional assays, TMEM88 demonstrates a dose-dependent inhibition of Wnt/β-catenin signaling. When HEK293 cells were co-transfected with Wnt-1 and increasing amounts of TMEM88, researchers observed progressive attenuation of Wnt-induced signaling . Conversely, TMEM88 knockdown by RNAi resulted in increased Wnt activity, further confirming its inhibitory role .

In developmental contexts, such as Xenopus embryo studies, TMEM88 specifically inhibits Wnt signaling induced by Xdsh but not by β-catenin, indicating that it acts upstream of β-catenin in the signaling cascade . This selective inhibitory effect allows TMEM88 to modulate Wnt signaling in a context-dependent manner across different tissues and developmental stages.

What human isoforms of TMEM88 exist and how do they differ functionally?

Two primary isoforms of TMEM88 have been identified in humans: TMEM88 CRA_a and TMEM88 CRA_b . These isoforms exhibit significant functional differences:

IsoformPDZ Binding VWV DomainWnt/β-catenin RegulationPrimary Functions
TMEM88 CRA_aPresentCan inhibit pathwayCardiomyocyte differentiation, Cancer suppression (when membrane-bound)
TMEM88 CRA_bAbsentLimited regulationFunctions less well characterized

Only the TMEM88 CRA_a isoform contains the PDZ binding VWV domain that enables it to regulate the Wnt/β-catenin pathway through interaction with Dishevelled proteins . This structural difference creates distinct functional profiles between the isoforms, with TMEM88 CRA_a being more extensively studied due to its clear role in signaling regulation.

The differential expression of these isoforms may contribute to tissue-specific functions of TMEM88. In human cardiomyocyte differentiation and heart development, TMEM88 CRA_a appears to play a dominant role by downregulating the Wnt/β-catenin pathway . The selective expression of isoforms may represent an additional layer of regulation in TMEM88-mediated cellular processes.

What experimental systems are used to study TMEM88 function?

Researchers employ various experimental systems to investigate TMEM88 function, each offering distinct advantages:

Experimental SystemApplicationsKey Findings
Cell Lines (HEK293, A549, BCPAP, etc.)Signaling assays, Protein interactionsIdentified TMEM88's role in Wnt inhibition and cancer cell behavior
Xenopus EmbryosDevelopmental studies, Secondary axis formationConfirmed TMEM88's ability to inhibit Xdsh-induced secondary axis
Mouse ModelsTissue-specific expression, Developmental rolesRevealed correlation between TMEM88 and Wnt signaling genes in embryonic intestines
Cancer TissuesExpression analysis, Clinical correlationsFound downregulation in various cancers correlating with patient outcomes

For cell-based studies, researchers typically use luciferase reporter assays to measure Wnt pathway activity. The experimental procedure often involves co-transfection of cells with Lef-1 expression plasmid, Lef-1 luciferase reporter plasmid, GFP expression plasmid, Wnt-1 expression plasmid, and varying amounts of TMEM88 . This system allows for quantitative assessment of TMEM88's effects on Wnt signaling.

In Xenopus studies, researchers inject mRNAs encoding TMEM88 and other proteins of interest into specific regions of embryos at early developmental stages. The resulting phenotypes and luciferase assays from animal cap explants provide insights into TMEM88's developmental functions . This vertebrate model system has been particularly valuable for understanding TMEM88's role in embryonic development.

What methods are recommended for expressing and purifying recombinant TMEM88 protein?

The expression and purification of recombinant TMEM88 presents several challenges due to its transmembrane nature. Based on established protocols for similar proteins, researchers should consider the following methodological approach:

For the expression of recombinant TMEM88, a bacterial expression system using E. coli can be employed, though eukaryotic expression systems may provide better post-translational modifications. The method described for the PDZ domain of mouse Dishevelled-1 offers a starting point that can be adapted for TMEM88 :

  • Transform expression vector containing TMEM88 into an appropriate E. coli strain

  • For isotope labeling (if needed for structural studies), grow cells in medium with 15NH4Cl

  • Induce protein expression with IPTG when cell density reaches appropriate OD600

  • Optimize induction conditions: 16°C for 16 hours may reduce inclusion body formation

  • After cell lysis, purify using affinity chromatography (if a tag is incorporated)

  • Further purify using size exclusion chromatography on a Superdex 75 column

For membrane proteins like TMEM88, additional considerations include:

  • Using detergents for solubilization (e.g., DDM, CHAPS)

  • Incorporating a cleavable tag for final protein processing

  • Validating protein folding through circular dichroism or limited proteolysis

While working with full-length TMEM88 may be challenging, researchers often work with the C-terminal peptide containing the critical VWV motif. As described in the literature, this peptide (GSRSVPTPGKVWV, residues 147-159 of human TMEM88) can be chemically synthesized and purified by reverse-phase HPLC . This approach allows for focused study of the interaction domain without the challenges of purifying the full transmembrane protein.

How can researchers effectively measure TMEM88-Dishevelled interactions?

Several complementary techniques have proven effective for measuring TMEM88-Dishevelled interactions with varying degrees of sensitivity and information content:

  • NMR Spectroscopy: This technique provides detailed structural information about the interaction. Researchers have successfully used 15N heteronuclear single quantum coherence (HSQC) experiments to detect chemical shift perturbations in spectra of uniformly 15N-labeled PDZ domains of Dvl-1 upon addition of the TMEM88C peptide . The weighted chemical shift perturbations can be calculated using the equation: Δδ binding = ((Δδ 1H)2 + (Δδ 15N × 0.2)2)1/2.

  • Fluorescence Spectroscopy: This approach offers quantitative binding measurements. Using a spectrofluorometer, researchers can record the Trp fluorescent polarization of the Val-Trp-Val tripeptide and TMEM88C peptide with an excitation wavelength of 280 nm and an emission wavelength of 360 nm . The binding affinity can be determined by titrating increasing concentrations of the Dvl-1 PDZ domain.

  • Co-immunoprecipitation: For cell-based validation, co-immunoprecipitation experiments can confirm the interaction between full-length proteins in a cellular context. This typically involves expressing tagged versions of both proteins, immunoprecipitating one partner, and detecting the co-precipitated protein by Western blotting.

  • Functional Assays: Luciferase reporter assays provide indirect evidence of TMEM88-Dvl interaction by measuring the effect on Wnt signaling. Cells can be co-transfected with Lef-1 expression plasmid, Lef-1 luciferase reporter plasmid, and TMEM88 with or without Wnt-1 stimulation .

For researchers specifically interested in quantitative binding parameters, fluorescence spectroscopy offers advantages in determining binding constants. Using a minimagnetic stirring bar for equilibration during titration experiments ensures accurate measurements of the interaction strength between TMEM88 and the PDZ domain of Dishevelled.

What are optimal approaches for TMEM88 knockdown experiments?

TMEM88 knockdown experiments are essential for understanding the protein's function through loss-of-function studies. Based on published methodologies, researchers should consider the following optimized approach:

siRNA-Mediated Knockdown:

  • Select validated siRNA sequences targeting TMEM88 (e.g., TMEM88-HSS190049 from commercial suppliers)

  • Transfect cells using Lipofectamine 2000 or similar reagent following manufacturer's protocol

  • Include appropriate controls:

    • Negative control: non-targeting siRNA or lacZ

    • Positive control: siRNA targeting a housekeeping gene

  • Validate knockdown efficiency by qRT-PCR and Western blot at 48-72 hours post-transfection

  • Perform functional assays at optimal timepoints (typically 66-72 hours post-transfection)

For assessing the effect of TMEM88 knockdown on Wnt signaling, the TOPflash reporter system has been successfully employed. Researchers can transfect cells with TOPflash (T-cell factor reporter plasmid), GFP for normalization, and TMEM88 RNAi or control . After an appropriate culture period, cells can be lysed and subjected to GFP and luciferase measurement to quantify changes in Wnt pathway activity.

For longer-term studies, stable knockdown using shRNA may be preferable. This approach has been used to study TMEM88's role in cancer cells, where decreased expression of TMEM88 with shRNA favored cell growth and invasion, suggesting a tumor suppressor activity in certain contexts .

The optimal timing for analyzing knockdown effects depends on the specific cellular process being studied:

  • Signaling changes: 48-72 hours post-transfection

  • Proliferation: 3-5 days

  • Invasion/migration: 24-48 hours after reaching confluence

  • Gene expression changes: 48-72 hours post-transfection

How should researchers design experiments to differentiate between membrane-bound and cytosolic TMEM88 functions?

TMEM88 exhibits dual localization patterns (membrane-associated and cytosolic), with distinct functions reported for each localization . Designing experiments to differentiate between these functions requires careful methodology:

1. Subcellular Fractionation and Localization Assessment:

  • Perform subcellular fractionation to separate membrane and cytosolic fractions

  • Confirm fraction purity using markers (e.g., Na+/K+ ATPase for membrane, GAPDH for cytosol)

  • Quantify TMEM88 distribution between fractions by Western blotting

2. Generation of Localization-Specific Mutants:

  • Design membrane-targeting mutants by enhancing or adding membrane localization signals

  • Create cytosol-restricted mutants by removing transmembrane domains while preserving the VWV motif

  • Validate localization patterns by immunofluorescence microscopy

3. Function-Specific Assays:

LocalizationFunctional ReadoutsExpected Outcomes
Membrane-associatedWnt/β-catenin reporter assaysInhibition of pathway
Membrane-associatedExpression of Wnt target genes (cyclin D1, c-Myc, MMP7)Decreased expression
Membrane-associatedCell proliferation, colony formationDecreased in cancer cells
CytosolicContext-dependent assays based on cancer typeVariable outcomes

Research has demonstrated that membrane-associated TMEM88 inhibits the Wnt/β-catenin pathway in non-small cell lung cancer (NSCLC) cell lines (A549, H1299, H460, etc.), reducing the expression of Wnt target genes and decreasing proliferation, colony formation, migration, and invasion . Similar observations have been made in thyroid cancer cell lines (BCPAP, TPC1, K1, NPA87), where TMEM88 overexpression inhibited growth both in vitro and in vivo .

To establish causality between localization and function, researchers should perform rescue experiments where endogenous TMEM88 is knocked down and replaced with localization-specific variants. This approach can directly link observed phenotypes to specific subcellular pools of TMEM88.

What controls are essential in TMEM88 overexpression studies?

When designing TMEM88 overexpression experiments, incorporating appropriate controls is critical for obtaining reliable and interpretable results:

Essential Controls for TMEM88 Overexpression Studies:

  • Empty Vector Control: Cells transfected with the same vector backbone lacking the TMEM88 insert to account for effects of the transfection process and vector elements.

  • Expression Level Verification: Western blot analysis to confirm successful overexpression and quantify the level of TMEM88 protein relative to endogenous levels.

  • Subcellular Localization Control: Immunofluorescence or subcellular fractionation to verify that the overexpressed protein localizes correctly to membrane and/or cytosolic compartments.

  • Functional Domain Mutant: Overexpression of TMEM88 with mutations in the VWV motif to demonstrate specificity of effects mediated through Dvl interaction.

  • Isoform-Specific Controls: When studying particular isoforms (e.g., TMEM88 CRA_a vs. CRA_b), include both isoforms to compare their differential effects .

  • Dose-Dependent Response: Use multiple concentrations of TMEM88 expression plasmid to establish dose-dependency, as has been demonstrated in HEK293 cells where TMEM88 attenuated Wnt-1-induced signaling in a dose-dependent manner .

  • Pathway-Specific Readouts: Include multiple readouts of Wnt pathway activity, such as:

    • Luciferase reporter assays (TOPflash or LEF-1 reporters)

    • Western blots for active β-catenin

    • qRT-PCR for Wnt target genes (cyclin D1, c-Myc, MMP7)

How can contradictory data regarding TMEM88's role as both tumor suppressor and oncogene be reconciled?

The literature reports seemingly contradictory roles for TMEM88 in cancer, functioning as both a tumor suppressor and an oncogene depending on the cancer type and cellular context . This apparent discrepancy can be reconciled through several analytical approaches:

1. Context-Dependent Analysis Framework:

  • Systematically document TMEM88's effects across different cancer types

  • Identify patterns related to tissue origin, genetic background, and molecular subtypes

  • Analyze differences in signaling pathway status (particularly Wnt pathway components)

2. Subcellular Localization as a Determinant of Function:

  • In non-small cell lung cancer (NSCLC), membrane-associated TMEM88 demonstrates tumor suppressor activity by inhibiting the Wnt/β-catenin pathway

  • Cytosolic localization may have different functional outcomes

  • The ratio between membrane and cytosolic TMEM88 may determine the net effect on cancer progression

3. Isoform-Specific Effects:

  • TMEM88 CRA_a contains the PDZ binding VWV domain and can regulate Wnt signaling

  • TMEM88 CRA_b lacks this domain and may have distinct functions

  • The relative expression of these isoforms could explain differential effects across cancer types

4. Molecular Interaction Partners:

  • Beyond Dishevelled, TMEM88 may interact with different proteins across cell types

  • These alternative interactions could mediate different downstream effects

  • Comprehensive interactome analysis in different contexts could reveal mechanism

5. Integration with Clinical Data:

What considerations are important when analyzing TMEM88 expression data from clinical samples?

1. Sample Processing and Preparation:

  • RNA integrity assessment to ensure quality of expression data

  • Standardized protein extraction protocols for consistent Western blot results

  • Proper controls for normalization across samples

2. Expression Level Interpretation:

3. Isoform-Specific Analysis:

  • Use primers/antibodies that can distinguish between TMEM88 isoforms

  • Analyze the ratio between isoforms rather than just total expression

  • Be aware that functional consequences may differ between isoforms

4. Subcellular Localization Assessment:

  • When possible, assess membrane vs. cytosolic localization in tissue samples

  • Consider using immunohistochemistry with subcellular resolution

  • The localization pattern may be more predictive of function than total expression

5. Clinical Correlation Methodology:

6. Integration with Pathway Analysis:

  • Correlate TMEM88 expression with Wnt pathway activity markers

  • Assess relationship with known downstream targets (cyclin D1, c-Myc, MMP7)

  • Example: TMEM88 downregulation increases expression of active β-catenin and TCF/LEF transcriptional activity

In studies of thyroid cancer, researchers analyzed TMEM88 mRNA and protein levels in cancer tissues compared to adjacent healthy tissues, as well as in cancer cell lines relative to control cell lines . This comprehensive approach allowed them to establish TMEM88's downregulation as a consistent feature in thyroid cancer and provided the foundation for functional studies demonstrating its tumor suppressor role.

What emerging technologies could advance TMEM88 research?

Several cutting-edge technologies hold promise for advancing our understanding of TMEM88 biology and function:

1. CRISPR-Cas9 Genome Editing:

  • Generation of TMEM88 knockout cell lines and animal models

  • Domain-specific mutations to dissect functional regions

  • Knock-in of fluorescent tags for live-cell imaging of endogenous TMEM88

2. Single-Cell Transcriptomics:

  • Analysis of TMEM88 expression heterogeneity within tissues

  • Correlation with cell state and differentiation trajectories

  • Identification of cell populations where TMEM88 regulation is most critical

3. Proximity Labeling Proteomics:

  • BioID or APEX2 fusions to identify context-specific TMEM88 interactors

  • Compartment-specific interactome analysis (membrane vs. cytosolic)

  • Temporal dynamics of interaction networks during signaling events

4. Cryo-Electron Microscopy:

  • Structural characterization of TMEM88 in membrane environments

  • Visualization of TMEM88-Dishevelled complexes

  • Mechanistic insights into how TMEM88 regulates Wnt signaling components

5. Patient-Derived Organoids:

  • Functional studies in more physiologically relevant 3D models

  • Testing TMEM88 modulation in patient-specific contexts

  • Drug screening in TMEM88-modified organoids

6. Computational Approaches:

  • Molecular dynamics simulations of TMEM88-membrane interactions

  • Systems biology modeling of TMEM88's role in Wnt network dynamics

  • Machine learning analysis of expression patterns across cancer datasets

These technologies would address current limitations in TMEM88 research, such as the challenges in studying transmembrane proteins, the context-dependency of TMEM88 function, and the integration of molecular mechanisms with physiological outcomes. By combining these approaches, researchers could develop a more comprehensive understanding of TMEM88 biology and its therapeutic potential.

What are the unresolved questions in TMEM88 research?

Despite progress in understanding TMEM88 function, several critical questions remain unresolved:

1. Structural Biology:

  • What is the complete three-dimensional structure of TMEM88?

  • How does membrane integration affect TMEM88's interaction with Dishevelled?

  • What structural changes occur upon binding to interaction partners?

2. Regulation of TMEM88:

  • What mechanisms control TMEM88 expression at transcriptional and post-transcriptional levels?

  • How is TMEM88 subcellular localization regulated?

  • What post-translational modifications affect TMEM88 function?

3. Signaling Pathway Crosstalk:

  • Beyond Wnt signaling, what other pathways does TMEM88 influence?

  • How does TMEM88 integrate into broader signaling networks?

  • Does TMEM88 function change during development compared to adult tissues?

4. Cancer Biology Paradox:

  • What determines whether TMEM88 functions as a tumor suppressor or oncogene in a given context?

  • Are there cancer-specific mutations in TMEM88 that alter its function?

  • Can TMEM88 status be used as a biomarker for cancer prognosis or treatment response?

5. Therapeutic Potential:

  • Is TMEM88 a viable therapeutic target for cancer or other diseases?

  • How can TMEM88 function be selectively modulated in specific tissues?

  • What are potential off-target effects of TMEM88-directed therapies?

6. Evolutionary Significance:

  • How conserved is TMEM88 function across species?

  • Did TMEM88's role in Wnt regulation evolve early or late in metazoan evolution?

  • Are there organism-specific adaptations in TMEM88 function?

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.