Recombinant Mouse Transmembrane protein 91 (Tmem91)

Shipped with Ice Packs
In Stock

Description

Introduction to Recombinant Mouse Transmembrane Protein 91 (Tmem91)

Recombinant Mouse Transmembrane Protein 91, commonly referred to as Tmem91, is a multi-pass membrane protein that belongs to the Dispanin family. It is also known by other names such as SynDIG3, Dispanin subfamily C member 3, and DSPC3. Tmem91 is primarily studied for its role in cellular processes, including synapse differentiation and potentially in hematopoietic progenitor cell differentiation in humans .

Expression and Production

Tmem91 is produced using an in vitro E. coli expression system, resulting in a lyophilized powder form. The recombinant protein is typically stored at -20°C or -80°C to maintain stability. For reconstitution, sterile deionized water is recommended, with a concentration of 0.1-1.0 mg/mL. Adding glycerol (5-50%) is suggested for long-term storage to prevent degradation.

Biological Function

While specific biological functions of Tmem91 are still under investigation, it is predicted to play roles in cellular differentiation and possibly in synaptic functions. In humans, Tmem91 is thought to be involved in hematopoietic progenitor cell differentiation, though detailed mechanisms remain to be elucidated .

Research Applications

Recombinant Tmem91 is used in various research fields, including neuroscience, immunology, and developmental biology. It serves as a valuable tool for studying membrane protein interactions and functions, particularly in the context of synaptic differentiation and cellular development.

Table 2: Tmem91 Protein Characteristics

CharacteristicDescription
Protein Length172 amino acids
FamilyDispanin family
Subcellular LocationMembrane; Multi-pass membrane protein
SynonymsSynDIG3, DSPC3, Synapse differentiation-induced protein 3

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for fulfillment.
Lead Time
Delivery times vary by purchasing method and location. Contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Tmem91; SynDIG3; Transmembrane protein 91; Dispanin subfamily C member 3; DSPC3; Synapse differentiation-induced protein 3
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-172
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Tmem91
Target Protein Sequence
MDNSSIQELQQPLLPSITCDLLAPRSEKPELGTPFPETAFAESPRGWQLLLPPLPSVSAG LGEPETPDFEDTLSSDSDSDDDGGDRLSPLLPHDHLGLAVFSVLCCFWPVGIAAFCLAHK TNKAWAKGDVQGAGAASRRAFLLGVLAVGLGLCTYAAALVTLAAYLASRDPP
Uniprot No.

Target Background

Database Links
Protein Families
CD225/Dispanin family
Subcellular Location
Membrane; Multi-pass membrane protein.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.