Recombinant Mouse Transmembrane protein 93 (Tmem93)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. If you have specific format requirements, please indicate them when placing the order, and we will fulfill them accordingly.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery times.
Note: All our proteins are shipped with standard blue ice packs. If dry ice shipping is required, please inform us in advance, as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers may use this as a reference.
Shelf Life
The shelf life is influenced by various factors such as storage conditions, buffer composition, storage temperature, and protein stability. Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C, while lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type in mind, please inform us, and we will prioritize its development.
Synonyms
Emc6; Tmem93; ER membrane protein complex subunit 6; Transmembrane protein 93
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-110
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Emc6
Target Protein Sequence
MAAVVAKREGPPFISEAAVRGNAAVLDYCRTSVSALSGATAGILGLTGLYGFIFYLLASV LLSLLLILKAGRRWNKYFKSRRPLFTGGLIGGLFTYVLFWTFLYGMVHVY
Uniprot No.

Target Background

Function
Transmembrane protein 93 (Tmem93) is a component of the endoplasmic reticulum membrane protein complex (EMC). This complex plays a critical role in the energy-independent insertion of newly synthesized membrane proteins into the endoplasmic reticulum (ER) membrane. Tmem93 preferentially facilitates the insertion of proteins with transmembrane domains exhibiting weak hydrophobicity or containing destabilizing features such as charged and aromatic residues. It is involved in the cotranslational insertion of multi-pass membrane proteins where stop-transfer membrane-anchor sequences become ER membrane-spanning helices. Tmem93 is also essential for the post-translational insertion of tail-anchored (TA) proteins into ER membranes. By mediating the proper cotranslational insertion of N-terminal transmembrane domains in an N-exo topology, with the translocated N-terminus in the ER lumen, Tmem93 controls the topology of multi-pass membrane proteins, such as G protein-coupled receptors. Through its regulation of protein insertion into membranes, Tmem93 indirectly influences various cellular processes.
Database Links
Protein Families
EMC6 family
Subcellular Location
Endoplasmic reticulum membrane; Multi-pass membrane protein.

Q&A

What is Mouse Transmembrane protein 93 (Tmem93) and what are its known functions?

Transmembrane protein 93 (Tmem93), also known as ER membrane protein complex subunit 6 (Emc6), is a 110-amino acid transmembrane protein that functions as a component of the ER membrane protein complex (EMC) . The EMC is critically involved in the biogenesis of multipass membrane proteins, particularly those enriched for transporters and proteins containing transmembrane domains (TMDs) with challenging features such as charged amino acids . As part of the EMC, Tmem93/Emc6 participates in cotranslational membrane protein insertion, helping to stabilize transmembrane regions during biosynthesis prior to completion of protein folding .

How is recombinant Mouse Tmem93 typically produced for research applications?

Recombinant Mouse Tmem93 is typically produced using E. coli expression systems. The protein is commonly expressed with an N-terminal His-tag to facilitate purification and detection in experimental applications. After expression and purification, the protein is often prepared as a lyophilized powder with purity greater than 90% as determined by SDS-PAGE .

Production ParameterSpecification
Expression SystemE. coli
TagHis
Protein LengthFull Length (1-110)
FormLyophilized powder
Purity>90% (SDS-PAGE)

What are the optimal storage and reconstitution conditions for recombinant Mouse Tmem93?

For optimal stability and experimental reproducibility, recombinant Mouse Tmem93 should be stored at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple use to avoid repeated freeze-thaw cycles, which can degrade protein quality. Working aliquots may be stored at 4°C for up to one week .

For reconstitution:

  • Briefly centrifuge the vial prior to opening to bring contents to the bottom

  • Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL

  • Add glycerol to a final concentration of 5-50% (recommended concentration: 50%)

  • Aliquot for long-term storage at -20°C/-80°C

The protein is typically supplied in a Tris/PBS-based buffer containing 6% Trehalose at pH 8.0, which helps maintain stability during lyophilization and reconstitution .

What analytical methods are recommended for characterizing recombinant Mouse Tmem93?

While SDS-PAGE is the primary application mentioned in the product specifications , several analytical techniques are recommended for comprehensive characterization of recombinant membrane proteins like Tmem93:

  • SDS-PAGE: For purity assessment and molecular weight confirmation

  • Western Blotting: Using anti-His antibodies or specific anti-Tmem93 antibodies for identification

  • Mass Spectrometry: For precise molecular weight determination and post-translational modification analysis

  • Circular Dichroism (CD): To assess secondary structure composition

  • Size Exclusion Chromatography: To evaluate oligomeric state and aggregation tendency

  • Functional Assays: To verify biological activity through protein-protein interaction studies with other EMC components

How can researchers optimize solubilization of recombinant Tmem93 for functional studies?

As a transmembrane protein, Tmem93 presents challenges for solubilization while maintaining native conformation. Consider these methodological approaches:

  • Detergent Screening: Test multiple detergent types (mild non-ionic detergents like DDM or LMNG) at various concentrations

  • Buffer Optimization: Evaluate different pH conditions (typically pH 7.0-8.5) and salt concentrations

  • Additive Incorporation: Consider cholesterol, lipids, or stabilizing agents like glycerol

  • Temperature Control: Perform solubilization at 4°C to minimize protein denaturation

  • Time Optimization: Monitor solubilization efficiency over time to determine optimal extraction duration

For functional studies of membrane proteins like Tmem93, reconstitution into proteoliposomes or nanodiscs may provide a more native-like environment than detergent micelles.

How does Tmem93/Emc6 contribute to the structure and function of the ER Membrane Protein Complex?

Tmem93/Emc6 functions as a subunit of the ER Membrane Protein Complex (EMC), which plays a critical role in the biogenesis of multipass membrane proteins. Research indicates that the EMC typically engages with client proteins following synthesis of transmembrane domain clusters, particularly in proteins with charged residues in their transmembrane domains .

What experimental approaches can be used to study Tmem93's role in membrane protein biogenesis?

To investigate Tmem93's specific role in membrane protein biogenesis, researchers can employ several advanced experimental approaches:

  • Proximity-specific Ribosome Profiling: This technique can identify cotranslational interactions between Tmem93/Emc6 and nascent protein chains, revealing the timing and specificity of engagement .

  • CRISPR-mediated Depletion: Generating Tmem93/Emc6-depleted cell lines using CRISPRi technology can help identify potential client proteins through quantitative proteomics approaches like SILAC (Stable Isotope Labeling with Amino acids in Cell culture) .

  • Crosslinking Mass Spectrometry: This approach can identify interaction partners and contact sites between Tmem93/Emc6 and other components of the EMC or client proteins.

  • Cryo-EM Structural Analysis: For determining the position and structural contribution of Tmem93/Emc6 within the assembled EMC complex.

  • In vitro Reconstitution Assays: Using purified components to reconstitute membrane protein insertion machinery and assess the specific contribution of Tmem93/Emc6.

How can researchers evaluate the impact of Tmem93/Emc6 mutations on membrane protein biogenesis?

To systematically evaluate the impact of Tmem93/Emc6 mutations on membrane protein biogenesis:

  • Site-directed Mutagenesis: Create point mutations or deletion constructs of recombinant Tmem93/Emc6

  • Complementation Assays: Express mutant versions in Tmem93/Emc6-depleted cells and assess rescue of client protein biogenesis

  • Client Protein Reporters: Design fluorescent or enzymatic reporters fused to known EMC client proteins to quantitatively measure biogenesis efficiency

  • Structural Analysis of Mutants: Perform structural studies on mutant proteins to correlate functional defects with structural alterations

  • Interactome Analysis: Compare protein-protein interaction profiles between wild-type and mutant Tmem93/Emc6 using affinity purification coupled with mass spectrometry

What are common challenges when working with recombinant Tmem93 and how can they be addressed?

ChallengePotential Solution
Low solubilityOptimize detergent type and concentration; consider nanodiscs or amphipols
Protein aggregationAdd stabilizing agents; optimize buffer composition; maintain low temperature
Poor reconstitutionCentrifuge vial before opening; use recommended buffer conditions; avoid vortexing
Protein degradationAdd protease inhibitors; minimize freeze-thaw cycles; store in appropriate conditions
Limited activityEnsure proper folding; optimize lipid environment; verify intact N/C termini

How can researchers differentiate between functional and non-functional recombinant Tmem93 preparations?

Assessing functionality of recombinant Tmem93 preparations requires methodical approaches:

  • Structural Integrity Assessment: Use circular dichroism or thermal shift assays to confirm proper folding

  • Interaction Assays: Verify interactions with known EMC component proteins using pull-down assays or surface plasmon resonance

  • Complementation Testing: Determine if the recombinant protein can rescue phenotypes in Tmem93/Emc6-depleted cells

  • Client Protein Biogenesis Assays: Measure the ability to support biogenesis of known EMC client proteins in reconstituted systems

  • Membrane Insertion Activity: For advanced applications, develop assays to measure contribution to membrane protein insertion directly

What controls should be included when studying Tmem93's role in membrane protein biogenesis?

Robust experimental design requires appropriate controls:

  • Positive Controls: Include well-characterized EMC client proteins known to depend on the complex for biogenesis

  • Negative Controls: Include membrane proteins that fold independently of the EMC

  • Specificity Controls: Test proteins with varying numbers of transmembrane domains and different amino acid compositions in TMDs

  • System Controls: Include controls for expression system effects (e.g., comparison of E. coli vs. mammalian expression)

  • Technical Controls: For proper protein handling (e.g., heat-denatured protein, storage time controls)

How might the EMC and Tmem93/Emc6 be involved in disease pathogenesis?

Current research suggests the EMC's role in membrane protein biogenesis may have implications for various diseases:

  • Neurodegenerative Disorders: Given the importance of membrane protein homeostasis in neurons, disruption of EMC function could contribute to protein misfolding diseases

  • Metabolic Diseases: Since many transporters depend on the EMC for proper biogenesis , EMC dysfunction might affect nutrient transport and metabolism

  • Cancer Biology: Altered membrane protein composition is a hallmark of many cancers; EMC regulation may influence cancer cell membrane properties

  • Viral Infections: Some viruses utilize host membrane protein insertion machinery; the EMC might be exploited during viral replication

Research into Tmem93/Emc6's specific contributions to these processes represents an important frontier in understanding disease mechanisms.

What emerging technologies might advance our understanding of Tmem93/Emc6 function?

Several cutting-edge technologies hold promise for deeper insights into Tmem93/Emc6 function:

  • AlphaFold and Other AI-driven Structural Prediction: To model Tmem93/Emc6 structure and interactions within the EMC

  • Single-molecule Techniques: Including fluorescence resonance energy transfer (FRET) and force spectroscopy to study dynamic interactions during membrane protein insertion

  • In-cell NMR: To study Tmem93/Emc6 structure and dynamics in native cellular environments

  • Integrative Structural Biology: Combining cryo-EM, crosslinking mass spectrometry, and computational modeling to build comprehensive structural models

  • Synthetic Biology Approaches: Engineer minimal systems to define the essential components and mechanisms of EMC-mediated membrane protein biogenesis

How should researchers interpret changes in Tmem93/Emc6 expression or localization in experimental systems?

When analyzing changes in Tmem93/Emc6 expression or localization:

  • Consider Context: Interpret changes in relation to other EMC components, as evidence suggests some components (like EMC2) can affect the abundance of the entire complex, while others (like EMC4) may not

  • Functional Correlation: Assess whether expression changes correlate with alterations in client protein biogenesis or stability

  • Localization Significance: Determine if localization changes reflect altered ER morphology, stress responses, or redistribution within membrane subdomains

  • Temporal Dynamics: Consider the timing of changes in relation to cellular processes like differentiation, stress response, or cell cycle progression

  • System-specific Effects: Account for potential differences between model systems (e.g., yeast vs. mammalian cells) when interpreting results

What bioinformatic approaches can help identify potential Tmem93/Emc6 client proteins or interaction partners?

Computational methods to identify potential clients or interactors include:

  • Transmembrane Domain Analysis: Screen for proteins with charged or polar residues in TMDs, as EMC clients are enriched for these features

  • Evolutionary Co-variation Analysis: Identify proteins that show correlated evolutionary patterns with Tmem93/Emc6

  • Expression Correlation Analysis: Examine transcriptomic and proteomic databases for genes with expression patterns that correlate with Tmem93/Emc6

  • Structural Modeling: Use protein structure prediction to identify potential interaction interfaces

  • Network Analysis: Analyze protein-protein interaction networks to identify functional clusters involving Tmem93/Emc6

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.