Recombinant Mouse Transmembrane protein 9B (Tmem9b)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for customized preparation.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Our proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default glycerol concentration is 50%, which can serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
The tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Tmem9b; Transmembrane protein 9B
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
35-199
Protein Length
Full Length of Mature Protein
Species
Mus musculus (Mouse)
Target Names
Tmem9b
Target Protein Sequence
AKNFEDVRCKCICPPYKENPGHIYNKNISQKDCDCLHVVEPMPVRGPDVEAYCLRCECKY EERSSVTIKVTIIIYLSILGLLLLYMVYLTLVEPILKRRLFGHSQLLQSDDDVGDHQPFA NAHDVLARSRSRANVLNKVEYAQQRWKLQVQEQRKSVFDRHVVLS
Uniprot No.

Target Background

Function
Enhances the production of proinflammatory cytokines induced by TNF, IL-1β, and TLR ligands. Plays a role in TNF activation of both the NF-κB and MAPK pathways.
Database Links
Protein Families
TMEM9 family
Subcellular Location
Lysosome membrane; Single-pass membrane protein. Early endosome membrane; Single-pass membrane protein.

Q&A

What is the basic structure and function of TMEM9B?

TMEM9B (Transmembrane protein 9B) is a single-span type I transmembrane protein located on chromosome 11. It consists of 124 amino acid residues with approximately 25.81% of its sequence predicted to be disordered . Functionally, TMEM9B enhances the production of pro-inflammatory cytokines induced by tumor necrosis factor (TNF), interleukin-1 beta (IL1B), and Toll-like receptor (TLR) ligands . It plays a crucial role in TNF activation of both the nuclear factor kappa B (NF-κB) and mitogen-activated protein kinase (MAPK) pathways, contributing to inflammatory responses .

The protein is known by several alternative names including C11orf15, UNQ712/PRO1375, and is present in humans, mice, and rats with high sequence homology, making mouse models valuable for studying its function. Western blot analysis typically reveals a band of approximately 23 kDa, corresponding to the predicted molecular weight of the protein .

How does TMEM9B interact with other proteins in cellular systems?

TMEM9B demonstrates specific interactions with endosomal chloride/proton (Cl⁻/H⁺) antiporters, particularly ClC-3 and ClC-4, but shows minimal interaction with the lysosomal ClC-7 and muscle ClC-1 channels . This selectivity suggests a specialized role in endosomal function.

The interaction between TMEM9B and these transporters has been conclusively demonstrated through Förster Resonance Energy Transfer (FRET) techniques, specifically using fluorescence lifetime imaging microscopy (FLIM-FRET). This approach detected significant energy transfer between TMEM9B and both ClC-3 and ClC-4, confirming their physical proximity (within approximately 5 nm) and providing strong evidence for direct protein-protein interaction .

When co-expressed with ClC-4, TMEM9B suppresses its function, while co-expression with ClC-3 both reduces activity and induces a distinct slowing of activation kinetics in the time course of ion transport . These functional modifications suggest that TMEM9B serves as a regulatory component for these transporters in endosomal compartments.

What experimental models are suitable for studying TMEM9B?

Several experimental models have proven effective for TMEM9B research:

  • Cell lines: HeLa, HepG2, and BxPC-3 cells express TMEM9B and are suitable for in vitro studies as demonstrated by western blot analysis . These cell lines allow for investigation of TMEM9B's function in different cellular contexts.

  • Xenopus oocytes: This system has been successfully employed for electrophysiological studies of TMEM9B's effect on ClC transporters. The large size of oocytes facilitates microinjection of RNA encoding TMEM9B and its interacting partners, allowing for precise control of expression levels .

  • Transfected HEK cells: These cells provide another system for analyzing TMEM9B function, particularly for electrophysiological measurements and protein interaction studies .

  • Animal tissues: Mouse and rat brain lysates have been used to study endogenous TMEM9B expression, with reliable detection using appropriate antibodies .

  • Knockout models: While not extensively characterized in the provided data, a Tmem9b knockout mouse has been generated, though it reportedly showed no overt phenotype in initial analyses that focused primarily on cancer-related aspects .

How does TMEM9B regulate endosomal chloride/proton antiporter function?

TMEM9B exhibits a specific regulatory effect on endosomal chloride/proton antiporters ClC-3 and ClC-4, with minimal impact on the lysosomal ClC-7 or the muscle channel ClC-1 . This regulatory interaction involves multiple mechanisms:

The regulatory impact of TMEM9B on these transporters may have significant implications for endosomal pH regulation, ion homeostasis, and vesicular trafficking, potentially influencing multiple cellular processes including receptor recycling, protein degradation, and signaling pathway modulation.

What is the role of TMEM9B in neurological disorders related to CLCN3 and CLCN4 mutations?

The discovery of TMEM9B as a novel interaction partner of ClC-3 and ClC-4 transporters has important implications for understanding neurological disorders associated with CLCN3 and CLCN4 mutations . While specific pathological mechanisms remain under investigation, several aspects merit consideration:

  • Endosomal homeostasis: Since TMEM9B regulates ClC-3 and ClC-4 function, alterations in TMEM9B expression or activity might exacerbate or ameliorate phenotypes associated with mutations in these transporters. The maintenance of proper endosomal pH and ion composition is critical for neuronal function .

  • Potential therapeutic target: Understanding TMEM9B's regulatory role could potentially identify new therapeutic strategies for disorders linked to ClC transporter dysfunction. Modulating TMEM9B expression or its interaction with these transporters might help normalize their function in disease states .

  • Diagnostic implications: Analysis of TMEM9B expression or mutations could potentially serve as biomarkers or prognostic indicators in patients with CLCN3 or CLCN4-related conditions, though this application requires further investigation .

The neurological relevance of this interaction is underscored by the expression of these proteins in brain tissue, as demonstrated by western blot analysis of mouse and rat brain lysates .

How does TMEM9B contribute to inflammatory signaling pathways?

TMEM9B enhances the production of pro-inflammatory cytokines induced by TNF, IL1B, and TLR ligands, suggesting a critical role in amplifying inflammatory responses . Its contribution to inflammatory signaling involves:

  • NF-κB pathway modulation: TMEM9B participates in TNF-induced activation of the NF-κB pathway, a master regulator of inflammatory gene expression. This suggests a role in the nuclear translocation of NF-κB subunits and subsequent transcriptional activation of inflammatory genes .

  • MAPK pathway regulation: TMEM9B also influences the mitogen-activated protein kinase cascade triggered by TNF, which includes JNK, p38, and ERK pathways. These kinases regulate various aspects of the inflammatory response, including cytokine production and cell survival during inflammation .

  • Integration of multiple inflammatory stimuli: The ability of TMEM9B to enhance responses to diverse inflammatory triggers (TNF, IL1B, and TLR ligands) indicates its position as a convergence point in inflammatory signaling, potentially serving as an amplifier of inflammatory responses regardless of the initiating stimulus .

The dual role of TMEM9B in both inflammatory signaling and endosomal transport regulation suggests potential crosstalk between these cellular processes, which may be significant for understanding inflammation in both physiological and pathological contexts.

What are the optimal techniques for measuring TMEM9B-mediated regulation of ClC transporters?

Several specialized techniques have proven effective for investigating TMEM9B's regulatory effects on ClC transporters:

  • Electrophysiological recordings in Xenopus oocytes:

    • RNA microinjection allows controlled expression of ClC transporters with or without TMEM9B

    • Voltage protocols using 10 ms duration pulses with 10 mV decrements from +170 mV to -10 mV from a holding potential of -30 mV effectively capture the impact on ClC-3 and ClC-4 currents

    • Baseline subtraction and normalization to current values at 170 mV for the respective wild-type without TMEM9B provides reliable quantification

    • For detecting TMEM9B-induced slowing of activation, 500 ms activating test pulses to positive voltages followed by a constant -80 mV tail pulse are optimal

  • Capacitive and leak current correction:

    • Implementation of P/N subtraction procedures using scaled-down measurement protocols (0.2×) with subsequent scaling and subtraction of resultant currents from raw currents ensures accurate measurements

  • FLIM-FRET for protein interaction studies:

    • Fluorescence lifetime imaging microscopy-based FRET techniques are ideal for confirming direct interaction between TMEM9B and ClC transporters

    • This approach detects energy transfer only when proteins are within approximately 5 nm of each other, providing strong evidence for direct protein-protein interaction

    • The technique successfully discriminates between strong interactions (TMEM9B with ClC-3 and ClC-4) and minimal interactions (TMEM9B with ClC-1 and ClC-7)

  • Transfected HEK cell studies:

    • Complement oocyte experiments by allowing investigation in a mammalian cell context

    • Enable detailed subcellular localization studies through immunofluorescence techniques

These methodologies, when used in combination, provide comprehensive insight into both the functional impact and physical basis of TMEM9B's regulatory effects on ClC transporters.

What antibody-based detection methods work best for TMEM9B research?

Based on the available data, several antibody-based detection methods have been validated for TMEM9B research:

  • Western blot analysis:

    • Rabbit recombinant monoclonal antibodies against TMEM9B (e.g., EPR14339) have been extensively validated

    • Optimal dilution range of 1/1000 to 1/10000 depending on sample type and detection system

    • Effective for detecting TMEM9B in human cell lines (HeLa, HepG2, BxPC-3) at approximately 23 kDa, corresponding to the predicted molecular weight

    • Successfully detects TMEM9B in mouse and rat brain lysates, confirming cross-reactivity with rodent homologs

  • Immunocytochemistry/Immunofluorescence (ICC/IF):

    • Paraformaldehyde fixation (4%) provides good antigen preservation

    • Antibody dilution of approximately 1/100 followed by fluorophore-conjugated secondary antibodies (e.g., AlexaFluor® 555) at 1/200 yields specific signals

    • Particularly effective in HepG2 cells, allowing subcellular localization studies

  • Sample preparation considerations:

    • Cell lysates at 10-20 μg per lane provide adequate signal in western blots

    • For brain tissue samples, proper homogenization techniques and protein extraction buffers are critical for maintaining TMEM9B integrity

  • Carrier-free antibody formats:

    • Available for specialized applications like fluorochrome conjugation, metal isotope labeling, or use in multiplex imaging

    • Suitable for flow-based assays including mass cytometry

These validated methods provide reliable tools for TMEM9B detection across multiple experimental platforms, enabling both expression analysis and localization studies.

How can researchers distinguish between direct and indirect effects of TMEM9B on cellular functions?

Distinguishing direct from indirect effects of TMEM9B requires a multi-faceted experimental approach:

By combining these approaches, researchers can confidently discriminate between TMEM9B's direct regulatory actions and potential secondary effects mediated through downstream signaling pathways.

What factors might contribute to variability in TMEM9B experimental results?

Several factors can influence experimental outcomes when studying TMEM9B:

Awareness of these potential sources of variability enables researchers to design more robust experiments with appropriate controls and standardized methodologies.

How might TMEM9B be targeted in therapeutic development for inflammatory disorders?

TMEM9B's role in enhancing pro-inflammatory cytokine production induced by TNF, IL1B, and TLR ligands, along with its involvement in both NF-κB and MAPK pathways, positions it as a potential therapeutic target for inflammatory conditions . Several approaches warrant consideration:

  • Inhibition strategies:

    • Small molecule inhibitors targeting TMEM9B-ClC transporter interactions could modulate endosomal function and potentially dampen inflammatory responses

    • Peptide-based disruption of protein-protein interactions between TMEM9B and its binding partners offers another selective approach

    • RNA interference or antisense oligonucleotides could reduce TMEM9B expression in specific tissues

  • Pathway-specific modulation:

    • Compounds that selectively interfere with TMEM9B's role in either NF-κB or MAPK pathways could provide more tailored anti-inflammatory effects

    • Such selective modulation might reduce side effects compared to broader pathway inhibitors

  • Endosomal pH regulation:

    • Since TMEM9B regulates ClC-3 and ClC-4 transporters that influence endosomal pH, compounds affecting this interaction could potentially alter inflammatory signaling from endosomal compartments

    • Modulating endosomal acidification might impact receptor recycling and signaling pathway activation in inflammatory contexts

  • Biomarker applications:

    • TMEM9B expression levels or post-translational modification patterns could potentially serve as biomarkers for inflammatory disease activity or treatment response

    • Analysis of TMEM9B in patient samples might help stratify individuals for specific therapeutic approaches

While these approaches show theoretical promise, their practical implementation requires further investigation of TMEM9B's tissue-specific roles and the consequences of its inhibition in various physiological contexts.

What role might TMEM9B play in neurological disorders related to endosomal dysfunction?

The discovery of TMEM9B as a regulator of endosomal ClC-3 and ClC-4 transporters opens new avenues for understanding neurological disorders associated with endosomal dysfunction :

  • Neurodevelopmental disorders:

    • Mutations in CLCN4 are associated with X-linked intellectual disability, epilepsy, and behavioral abnormalities

    • TMEM9B's regulatory effect on ClC-4 suggests it might influence these pathologies by modulating endosomal function

    • Changes in endosomal pH and ion composition can affect neuronal development and synaptic function

  • Neurodegenerative diseases:

    • Endosomal dysfunction is implicated in various neurodegenerative disorders including Alzheimer's and Parkinson's diseases

    • TMEM9B's role in regulating endosomal transporters may influence protein degradation, autophagy, and vesicular trafficking pathways relevant to neurodegeneration

    • The expression of TMEM9B in brain tissue supports its potential neurological significance

  • Neuroimmune interactions:

    • TMEM9B's dual role in inflammatory signaling and endosomal regulation suggests it might serve as a nexus between neuroimmune responses and vesicular trafficking

    • This intersection could be particularly relevant in neuroinflammatory conditions such as multiple sclerosis or neuroinfectious diseases

  • Therapeutic implications:

    • Modulating TMEM9B-ClC interactions could potentially normalize endosomal function in disorders associated with CLCN3 or CLCN4 mutations

    • Such approaches might help restore proper endosomal pH regulation, receptor recycling, and protein degradation in affected neurons

Research in this area is still developing, but the identification of TMEM9B as a specific regulator of neuronal endosomal transporters provides a promising new direction for understanding and potentially treating disorders associated with endosomal dysfunction.

What are the most promising directions for future TMEM9B research?

Based on current knowledge, several research directions hold particular promise:

  • Structural biology approaches:

    • Determination of TMEM9B's three-dimensional structure alone and in complex with ClC transporters would provide crucial insights into interaction mechanisms

    • Cryo-electron microscopy of TMEM9B-ClC complexes could reveal the structural basis for functional regulation

    • Such structural information would facilitate rational design of compounds targeting these interactions

  • Tissue-specific functions:

    • Comprehensive characterization of TMEM9B's role across different tissues, particularly in the nervous system and immune cells

    • Generation of conditional knockout models to overcome potential developmental compensation seen in global knockouts

    • Investigation of potential isoform-specific functions in different cellular contexts

  • Integration of dual functions:

    • Exploring the potential crosstalk between TMEM9B's roles in inflammatory signaling and endosomal transport regulation

    • Determining whether these functions are mechanistically linked or represent independent activities

    • Investigating how changes in endosomal pH might influence inflammatory signaling pathway activation

  • Disease associations:

    • Comprehensive analysis of TMEM9B expression, mutations, or polymorphisms in patients with inflammatory disorders or neurological conditions linked to endosomal dysfunction

    • Investigation of TMEM9B's potential role in cancer progression, building on preliminary observations of its involvement in several cancer types

  • Technological innovations:

    • Development of specific antibodies or small molecules that can selectively modulate TMEM9B-ClC interactions

    • Application of advanced imaging techniques to visualize TMEM9B-mediated regulation of endosomal dynamics in real-time

    • Implementation of proteomics approaches to identify the complete interactome of TMEM9B beyond currently known partners

These research directions would substantially advance our understanding of TMEM9B's biological functions and potential therapeutic applications.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.