Recombinant Mouse Transmembrane protein C14orf180 homolog

Shipped with Ice Packs
In Stock

Description

Overview of Recombinant Mouse Transmembrane Protein C14orf180 Homolog

Recombinant Mouse Transmembrane protein C14orf180 homolog, also known as Nrac (Nutritionally-regulated adipose and cardiac-enriched protein), is a protein-coding gene that has a human ortholog named C14orf180 . It is considered a novel nutritionally-regulated gene enriched in adipose and cardiac tissues . The mouse Nrac protein sequence consists of 165 amino acids, while its human counterpart has 160 amino acids; an alignment shows 50% of the residues are identical between the two .

Basic Information

CharacteristicDescription
Gene NameC14orf180 (chromosome 14 open reading frame 180)
Other NamesNRAC; C14orf77
Gene ID400258
LocationChromosome 14q32.33
SequenceChromosome: 14; NC_000014.9 (104579764..104590515)
Number of Exons6
Molecular WeightApproximately 18 kDa[N/A]
Predicted ActivityPlasma membrane
Tissue SpecificityPredominantly expressed in white and brown adipose tissue, also found in the heart
OrthologsPresent in mammals and some vertebrates like Nile Tilapia and arboreal lizards
Biological ActivitiesMarker for adipocytes, potential functions in metabolism
Post-Translational ModsSingle-pass membrane protein

Expression and Regulation

Nrac gene expression is significantly influenced by nutritional status. Studies have shown that both fasting and obesity can reduce Nrac expression in white adipose tissue, with fasting also reducing its expression in brown fat . Additionally, Nrac is highly induced during adipocyte differentiation .

Functional Significance

Nrac is considered a novel adipocyte marker with potential functions in metabolism . Its expression pattern and regulation suggest it plays a role in how the body responds to changes in nutritional status.

Production and Sourcing

Recombinant Mouse Transmembrane protein C14orf180 homolog is produced in various expression systems, including E. coli, yeast, baculovirus, and mammalian cells. The recombinant protein is available with different tags, such as a His tag, for purification and detection purposes .

Research Findings

  • Identification as a Nutritionally-Regulated Gene: RNA-seq experiments identified Nrac as a gene sensitive to nutritional stimulation in white adipose tissue of mice treated with a high-fat diet or fasting .

  • Tissue-Specific Expression: Nrac exhibits specific and abundant expression in fat and heart tissues .

  • Ortholog Conservation: The gene has orthologs in various mammalian species and some other vertebrates, indicating evolutionary conservation .

Clinical Significance

As a nutritionally-regulated gene enriched in adipose and cardiac tissues, Recombinant Mouse Transmembrane protein C14orf180 homolog may be relevant in the context of metabolic disorders such as obesity and related cardiovascular complications .

Available Tests and Resources

Clinical resources and available tests related to C14orf180 can be found via the NCBI Gene database . This includes links to practice guidelines and authoritative resources.

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order remarks to ensure fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please consult your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and may serve as a guideline.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms maintain stability for 12 months under the same conditions.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot for multiple uses to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type will be determined during production. If a specific tag is required, please inform us, and we will prioritize its inclusion.
Synonyms
Nrac; Nutritionally-regulated adipose and cardiac-enriched protein
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-165
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Nrac
Target Protein Sequence
MRSAARVSRSNSHPRTRHPTRENEGTTWGSQPSRTERDGDRKCPPSILRPRRQECGCHGG EPQKTSRHVRFREPLEVAVHYIARKDTTAAIKVPSRPASHGGSPLQPASCSGSLFLWLTL CALLGVVLVLYCGQAKRVTAALEDLLAQLLALILRLWRVVLACWH
Uniprot No.

Target Background

Gene References Into Functions
  1. Nrac (gene A530016L24Rik) is a plasma membrane-localized protein highly upregulated during adipocyte differentiation. PMID: 23029450
Database Links
Subcellular Location
Cell membrane; Single-pass membrane protein.
Tissue Specificity
Predominantly expressed in white adipose tissue (at protein level) and brown adipose tissue. Also detected in heart.

Q&A

What are the optimal storage conditions for this protein?

The optimal storage conditions for Recombinant Mouse Transmembrane protein C14orf180 homolog are crucial for maintaining its structural integrity and biological activity. The protein should be stored at -20°C for regular use, or at -80°C for extended storage periods. For working solutions, it is recommended to store aliquots at 4°C for up to one week to minimize freeze-thaw cycles, which can significantly degrade protein quality. The protein is typically supplied in a storage buffer consisting of Tris-based buffer with approximately 50% glycerol, optimized for maintaining protein stability .

Storage ConditionRecommended TemperatureMaximum Storage Duration
Long-term storage−20°C to −80°CMonths to years
Working aliquots4°CUp to one week
Reconstituted protein−20°C2-3 months (avoid repeated freeze-thaw)

Repeated freeze-thaw cycles should be strictly avoided as they can lead to protein denaturation and loss of biological activity .

How should the lyophilized protein be reconstituted for experimental use?

To properly reconstitute the lyophilized Recombinant Mouse Transmembrane protein C14orf180 homolog:

  • Briefly centrifuge the vial prior to opening to bring all contents to the bottom.

  • Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.

  • Add glycerol to a final concentration of 5-50% for stabilization (50% is commonly recommended).

  • Aliquot the reconstituted protein into smaller volumes to minimize freeze-thaw cycles.

  • For optimal results, use freshly reconstituted protein for experiments whenever possible.

This reconstitution protocol ensures maximum protein stability and activity for subsequent experimental applications. The addition of glycerol acts as a cryoprotectant to prevent protein denaturation during freezing processes .

What study designs are most appropriate for evaluating treatment effects of C14orf180 homolog in mouse models?

When designing studies to evaluate the treatment effects of C14orf180 homolog in mouse models, several research designs should be considered:

  • Parallel Group Randomized Control Trials: These designs allow for unbiased estimation of mean treatment effects by comparing groups receiving the recombinant protein versus control conditions. This approach helps distinguish between natural outcome variability and actual treatment response .

  • Factorial Designs: Particularly useful when investigating whether C14orf180 homolog interacts with other treatments or factors. For example, a 2×2 factorial design could examine the protein's effects alongside nutritional interventions, revealing potential synergistic or antagonistic interactions .

  • Crossover Designs: These are highly recommended for assessing treatment heterogeneity (TRH) as they allow each subject to receive both the recombinant protein and control conditions in sequence. This design enables estimation of individual treatment effects, which is particularly valuable when investigating varying responses across different genetic backgrounds or physiological states .

  • Balaam Designs: These can be employed when concerns about carryover effects exist. They provide unbiased treatment effect estimates even in the presence of period-by-treatment interactions, though with potentially higher variance compared to traditional crossover designs .

The selection between these designs should consider the specific research questions, anticipated variability in response, and practical constraints such as sample availability and ethical considerations regarding repeated measures in animal models.

How can researchers accurately measure the functional activity of recombinant C14orf180 homolog?

Accurately measuring the functional activity of recombinant C14orf180 homolog requires a multi-faceted approach:

  • Binding Assays: Similar to methods used for other transmembrane proteins, researchers can develop solid-phase binding assays where the recombinant protein is immobilized, and binding to potential ligands or interaction partners is quantified. This approach has been successfully used with other recombinant proteins such as Galectin-9, which demonstrated cell adhesion support for T cells with an ED50 of 0.6-3 μg/mL .

  • Cell-Based Functional Assays: Develop assays that measure the protein's effect on relevant cell types, focusing on physiological processes that align with its reported nutritionally-regulated adipose and cardiac-enriched functions.

  • Signal Transduction Analysis: Assess downstream signaling pathway activation using phosphorylation-specific antibodies or reporter gene assays to quantify cellular responses.

  • Thermal Shift Assays: Measure protein stability and binding interactions through differential scanning fluorimetry to validate proper folding and function.

For all functional assays, appropriate positive and negative controls should be included, and statistical analysis should account for potential variability in response across different experimental conditions and biological replicates.

What are the key considerations for designing treatment response experiments with this protein?

When designing treatment response experiments with Recombinant Mouse Transmembrane protein C14orf180 homolog, researchers should carefully consider:

  • Distinction Between Change and Response: It is crucial to distinguish between simple change in outcome versus actual treatment response. This requires proper control groups to estimate what would have happened in the absence of treatment (the counterfactual outcome) .

  • Treatment Response Heterogeneity (TRH): Account for the possibility that different subjects may respond differently to the protein. This heterogeneity may be driven by both measurable and unmeasurable covariates. Experimental designs that allow for within-subject comparisons (like crossover designs) are particularly valuable for assessing TRH .

  • Dose-Response Relationships: Establish a dose-response curve by testing multiple concentrations, typically ranging from 0.1 to 10 μg/mL based on similar recombinant protein studies .

  • Timing Considerations: Determine optimal time points for measuring responses, considering both immediate and delayed effects.

  • Relevant Endpoints: Select endpoints that directly relate to the protein's known or hypothesized biological functions, particularly in nutritionally-regulated pathways and cardiac/adipose tissues, given its alternative name (Nrac).

These considerations will help ensure that experiments generate reliable and interpretable data about the protein's biological activities and potential applications.

How can crossover designs be optimized for assessing treatment heterogeneity with C14orf180 homolog?

Optimizing crossover designs for assessing treatment heterogeneity with C14orf180 homolog requires several methodological considerations:

  • Statistical Modeling Approach: Implement mixed-effects models that include fixed effects for treatment and random effects for each subject and treatment-subject interaction. This approach, as demonstrated by Gewandter et al. in pain treatment studies, allows for separation of patient heterogeneity on outcome from treatment heterogeneity seen in patients .

  • Washout Period Determination: Carefully determine appropriate washout periods between treatment sequences to minimize carryover effects. This is particularly important for transmembrane proteins like C14orf180 homolog, which may have persistent effects on cellular signaling pathways.

  • Randomization Strategy: Ensure balanced randomization of subjects to different treatment sequences to minimize period and order effects.

  • Sample Size Calculation: Power the study adequately not just for detecting average treatment effects but also for identifying significant treatment heterogeneity. This typically requires larger sample sizes than studies focused solely on mean effects.

  • Biomarker Integration: Incorporate relevant biomarkers or genetic analyses to correlate with observed response patterns, potentially identifying factors driving heterogeneous responses. This approach can lead toward more personalized biological insights.

By implementing these optimizations, researchers can generate robust estimates of both population-average treatment effects and the variance of individual treatment effects, providing deeper insights into the biological mechanisms and potential applications of C14orf180 homolog .

What analytical techniques are recommended for assessing protein-protein interactions involving C14orf180 homolog?

For investigating protein-protein interactions involving Recombinant Mouse Transmembrane protein C14orf180 homolog, several analytical techniques are recommended:

  • Co-Immunoprecipitation (Co-IP): Using anti-His tag antibodies to pull down the recombinant protein and identify binding partners through mass spectrometry. This technique is particularly useful for identifying native binding partners in relevant cell lysates.

  • Surface Plasmon Resonance (SPR): Provides real-time, label-free quantification of binding kinetics between the immobilized C14orf180 homolog and potential interaction partners. This technique yields association (ka) and dissociation (kd) rate constants and equilibrium dissociation constants (KD).

  • Bioluminescence Resonance Energy Transfer (BRET): For studying interactions in living cells, providing insights into the cellular context and compartmentalization of interactions.

  • Protein Microarrays: High-throughput screening of potential binding partners against immobilized C14orf180 homolog can reveal unexpected interactions.

  • Crosslinking Mass Spectrometry (XL-MS): Combines chemical crosslinking with mass spectrometry to identify interaction interfaces at the amino acid level.

Each technique has specific strengths and limitations, and often a combination of approaches provides the most comprehensive understanding of protein-protein interaction networks. Data analysis should include appropriate statistical methods to distinguish specific from non-specific interactions.

How can researchers develop valid knockout/knockdown models to study C14orf180 homolog function?

Developing valid knockout/knockdown models to study C14orf180 homolog function requires careful experimental design and validation:

  • CRISPR-Cas9 Knockout Strategies:

    • Design guide RNAs targeting conserved exons of the C14orf180 homolog gene

    • Verify knockout efficiency through genomic sequencing

    • Validate protein absence using Western blot with antibodies against the native protein

    • Assess compensatory mechanisms through transcriptomic analysis

  • RNA Interference Approaches:

    • Design siRNA or shRNA targeting different regions of the C14orf180 homolog mRNA

    • Optimize transfection conditions for target cell types

    • Validate knockdown efficiency at both mRNA (qRT-PCR) and protein (Western blot) levels

    • Implement inducible systems for temporal control of knockdown

  • Phenotypic Validation:

    • Perform comprehensive phenotypic characterization focusing on metabolic parameters, given the protein's association with nutritionally-regulated pathways

    • Conduct rescue experiments by reintroducing the recombinant protein to knockout cells/animals

    • Compare phenotypes between knockout and knockdown models to identify potential developmental compensation

  • Model System Selection:

    • Consider both in vitro cell culture models and in vivo mouse models

    • For in vivo studies, evaluate both conventional and conditional knockout approaches

    • Cell-type specific knockouts may be particularly valuable given the protein's name as "Nutritionally-regulated adipose and cardiac-enriched protein"

Careful validation of these models is essential to ensure that observed phenotypes are specifically attributable to the absence of C14orf180 homolog rather than off-target effects or compensatory mechanisms.

What are common challenges in expressing and purifying recombinant C14orf180 homolog?

Researchers may encounter several challenges when expressing and purifying Recombinant Mouse Transmembrane protein C14orf180 homolog:

  • Membrane Protein Solubility: As a transmembrane protein, C14orf180 homolog can exhibit poor solubility during expression and purification. This challenge can be addressed by:

    • Optimizing detergent selection for membrane protein extraction

    • Using fusion tags that enhance solubility (e.g., SUMO, MBP)

    • Implementing co-expression with chaperone proteins

  • Protein Misfolding: Transmembrane proteins often misfold during heterologous expression, particularly in E. coli systems. Strategies to mitigate include:

    • Lowering expression temperature (16-20°C)

    • Using specialized E. coli strains designed for membrane protein expression

    • Considering alternative expression systems (insect cells, mammalian cells)

  • Purification Optimization: His-tagged proteins may exhibit non-specific binding during purification. Recommendations include:

    • Including low concentrations of imidazole in binding and wash buffers

    • Utilizing stepped elution gradients

    • Implementing secondary purification steps (ion exchange, size exclusion)

  • Protein Stability Post-Purification: Maintaining stability of the purified protein requires:

    • Addition of glycerol (up to 50%) in storage buffers

    • Avoiding repeated freeze-thaw cycles

    • Aliquoting purified protein in small volumes for single use

These challenges necessitate careful optimization of expression and purification protocols specific to C14orf180 homolog to ensure high yield and quality of the recombinant protein for downstream applications.

How can researchers address inconsistent results in functional assays with this protein?

Addressing inconsistent results in functional assays with Recombinant Mouse Transmembrane protein C14orf180 homolog requires systematic troubleshooting:

  • Protein Quality Assessment:

    • Verify protein integrity by SDS-PAGE before each experiment

    • Assess the protein's native folding using circular dichroism or thermal shift assays

    • Consider using freshly reconstituted protein rather than stored aliquots for critical experiments

  • Experimental Standardization:

    • Develop robust standard operating procedures (SOPs) with precise handling instructions

    • Maintain consistent protein concentrations across experiments

    • Standardize buffer conditions, incubation times, and temperatures

  • Positive and Negative Controls:

    • Include well-characterized proteins with known activity levels as positive controls

    • Implement appropriate negative controls (denatured protein, irrelevant proteins)

    • Consider using structured approaches like factorial designs to identify interaction effects

  • Statistical Considerations:

    • Account for batch effects in statistical analyses

    • Consider crossover designs to distinguish between general outcome variability and treatment heterogeneity

    • Implement power calculations to ensure adequate sample sizes

  • Technical Validation:

    • Verify assay performance using orthogonal methods when possible

    • Assess reproducibility across different experimenters and laboratories

    • Document all experimental conditions meticulously

What are the best approaches for validating the specificity of observed effects with C14orf180 homolog?

Validating the specificity of observed effects with C14orf180 homolog requires multiple complementary approaches:

  • Competitive Binding Studies:

    • Implement dose-dependent competition experiments with unlabeled protein

    • Develop structurally similar but functionally inactive protein variants as controls

    • Use irrelevant proteins of similar size and charge as negative controls

  • Genetic Validation Approaches:

    • Correlate observed effects with gene expression levels in target tissues

    • Implement CRISPR knockout/knockdown models to confirm protein-specific effects

    • Perform rescue experiments reintroducing the recombinant protein to knockout systems

  • Antibody-Based Validation:

    • Use neutralizing antibodies specific to C14orf180 homolog to block observed effects

    • Implement epitope mapping to identify functional domains responsible for specific activities

    • Validate antibody specificity through appropriate controls

  • Structural Variations:

    • Test truncated versions of the protein to identify essential domains

    • Implement site-directed mutagenesis of key residues to establish structure-function relationships

    • Develop chimeric proteins to isolate functional domains

  • Cross-Species Validation:

    • Compare effects between mouse C14orf180 homolog and homologs from other species

    • Assess conservation of function across evolutionary distances

    • Identify species-specific differences that might inform mechanistic understanding

These validation approaches collectively provide strong evidence for the specificity of observed biological effects and help establish causal relationships between the protein and downstream phenotypes.

What emerging technologies might enhance our understanding of C14orf180 homolog function?

Several emerging technologies hold promise for enhancing our understanding of C14orf180 homolog function:

  • Single-Cell Proteomics: Enables examination of protein expression and modification at the single-cell level, potentially revealing cell type-specific functions of C14orf180 homolog in heterogeneous tissues, particularly in adipose and cardiac tissues where it is reported to be enriched.

  • Cryo-Electron Microscopy: Could resolve the three-dimensional structure of C14orf180 homolog at near-atomic resolution, especially valuable for transmembrane proteins that are challenging to crystallize. Structural insights would inform mechanism of action and potential binding partners.

  • Spatial Transcriptomics and Proteomics: These techniques provide spatial context to gene and protein expression, allowing researchers to map C14orf180 homolog expression in tissue microenvironments and correlate with functional outcomes.

  • Organoid Models: Patient-derived or engineered organoids can serve as physiologically relevant systems to study C14orf180 homolog function in three-dimensional tissue contexts that better recapitulate in vivo conditions.

  • CRISPR Activation/Interference Screens: Allow for genome-wide assessment of genes that modulate C14orf180 homolog function, potentially identifying novel pathway components and regulatory mechanisms.

  • Proteomics Interaction Networks: Advanced proteomic approaches such as BioID or APEX proximity labeling can identify proteins that physically interact with C14orf180 homolog in living cells, revealing the protein's functional context.

These technologies, particularly when used in combination, have the potential to dramatically advance our understanding of C14orf180 homolog's biological roles and mechanisms of action.

How might research on C14orf180 homolog inform understanding of related human conditions?

Research on Recombinant Mouse Transmembrane protein C14orf180 homolog (Nrac) has the potential to inform understanding of several human conditions, particularly given its alternative name as "Nutritionally-regulated adipose and cardiac-enriched protein":

  • Metabolic Disorders: The protein's nutritionally-regulated nature suggests potential roles in metabolic homeostasis. Research could reveal mechanisms relevant to conditions such as obesity, insulin resistance, and type 2 diabetes. Experimental designs using factorial approaches could elucidate interactions between this protein and nutritional interventions .

  • Cardiovascular Conditions: As a cardiac-enriched protein, C14orf180 homolog may play roles in cardiac function and pathology. Studies could investigate its expression and function in models of heart failure, cardiomyopathy, or cardiac hypertrophy.

  • Adipose Tissue Dysfunction: Given its enrichment in adipose tissue, understanding this protein's function may inform mechanisms of adipose tissue inflammation, dysfunction in obesity, or lipodystrophy syndromes.

  • Translational Research Approaches:

    • Comparative expression studies between mouse models and human tissue samples

    • Identification of human orthologs and their genetic variants associated with disease

    • Development of therapeutic approaches targeting the protein or its pathways

  • Personalized Medicine Applications: Understanding treatment heterogeneity in response to interventions affecting this protein could inform personalized approaches to metabolic and cardiovascular conditions. Crossover study designs would be particularly valuable for identifying factors driving differential responses .

Bridging research from mouse models to human applications will require careful consideration of species differences and validation in human systems, but offers significant potential for advancing understanding of metabolic and cardiovascular pathophysiology.

What are the most important considerations for researchers new to working with C14orf180 homolog?

Researchers new to working with Recombinant Mouse Transmembrane protein C14orf180 homolog should prioritize several key considerations:

  • Protein Handling and Storage: Adhere strictly to recommended storage conditions (-20°C to -80°C for long-term, 4°C for up to one week for working aliquots) and avoid repeated freeze-thaw cycles to maintain protein integrity and activity .

  • Experimental Design: Implement robust experimental designs that distinguish between general outcome variability and specific treatment responses. Consider crossover designs for assessing treatment heterogeneity when appropriate .

  • Functional Validation: Develop multiple complementary assays to validate protein function, and include appropriate positive and negative controls in all experiments.

  • Reconstitution Protocols: Follow established reconstitution protocols carefully, including centrifugation of the vial before opening, using sterile deionized water, and adding glycerol as a stabilizing agent .

  • Technical Optimization: Expect to spend significant time optimizing expression, purification, and functional assay conditions specific to this transmembrane protein.

  • Biological Context: Consider the protein's reported enrichment in adipose and cardiac tissues when designing physiologically relevant experiments.

  • Documentation: Maintain detailed records of all experimental conditions, protein batches, and observed variability to facilitate troubleshooting and ensure reproducibility.

By attending to these considerations, new researchers can establish reliable experimental systems for investigating the biological functions and potential applications of C14orf180 homolog, contributing meaningful advances to this field of study.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.