Recombinant Mouse Transmembrane protein C15orf27 homolog

Shipped with Ice Packs
In Stock

Description

Overview

The "Recombinant Mouse Transmembrane protein C15orf27 homolog" refers to a protein that is similar in structure and function to the human C15orf27 protein, but is found in mice and produced using recombinant DNA technology. C15orf27 is a human gene, with the protein product being a transmembrane protein. Homologs are genes or proteins that share a common ancestry and thus have similar characteristics. Recombinant proteins are produced by introducing the DNA encoding the protein into a host cell, such as bacteria or mammalian cells, and then culturing those cells to produce the protein in large quantities.

C15orf27 Function and Characteristics

The C15orf27 protein is a voltage-sensor domain (VSD) containing protein, but it lacks an ion pore . VSDs are typically found in voltage-gated ion channels, which are crucial for electrical signaling in cells. The VSDs in C15orf27 do not conduct protons or other ions . Research indicates the S4 segment in C15orf27 moves similarly to other VSDs, suggesting it may control a phosphatase's activity or regulate proton conduction, although C15orf27 itself does not conduct protons or ions .

Recombinant Production

Recombinant production involves using genetically engineered cells to produce the protein of interest. DNA encoding the mouse homolog of C15orf27 is inserted into an expression vector, which is then introduced into host cells. These cells, such as E. coli or mammalian cell lines, are cultured under controlled conditions to express the protein, which is then isolated and purified.

Potential Research Applications

Studying the recombinant mouse transmembrane protein C15orf27 homolog can provide insights into the function and regulation of its human counterpart. Some potential research applications include:

  • Understanding Protein Function: Investigating the precise role of C15orf27 in cellular processes.

  • Drug Discovery: Identifying small molecule modifiers that interact with C15orf27 to modulate its activity .

  • ** изучение роли белка C15orf27 в аутофагии.** .

  • ** изучение роли белка C15orf27 в передачи сигналов mTOR.** .

Related Research

Other research areas and proteins related to C15orf27 include:

  • Voltage-Sensitive Phosphatases (VSPs): Enzymes with VSDs that regulate phosphatase activity .

  • HV1 Proton Channels: Voltage-gated proton channels involved in regulating cellular pH and immune responses .

  • CD137: A protein involved in immune response regulation, relevant in the context of autoimmune diseases .

  • TMEM106B: Another transmembrane protein with roles in lysosomal membrane stability .

Data Table: Sequence Homology of DT Homologs

ToxinSpeciesSequence Identity to DTTranslocase ActivityCatalytic ActivityReference
DTCorynebacterium diphtheriae100%HighHigh
ACT1Austwickia chelonae20-40%SignificantFunctional
ACT2A. chelonae LK16-1820-40%SignificantFunctional

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice shipping is specifically requested and agreed upon in advance. Additional fees apply for dry ice shipping.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Tmem266; Transmembrane protein 266
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-538
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Tmem266
Target Protein Sequence
MALVTSFNMANPQPAIEGGISEVEIISQQVDEETKSIAPVQLVNFAYRDLPLAAVDLSTG GSQLLSNLDEEYQREGSDWLKPCCGKRAAVWQVFLLSASLNSFLVACVILVVILLTLELL IDTKLLQFSNAFQFAGVIHWISLVILSVFFSETVLRIVVLGIWDYIENKIEVFDGAVIIL SLAPMVASTVANGPRSPWDAISLIIMFRIWRVKRVIDAYVLPVKLEMEMVTQQYEKAKAI QDEQLERLTQICQEQGFEIRQLRAHLAQQDLDLAAEREAALQAPHVLSQPRSRYKVVEAG TWAEETAAESIVEELRPSQEATVKDDMNSYISQYYNGPSSDSGAPEPAVCVVTTAAIDIH QPNVPSDLFSVDLPLKLSGNSTCASATSETTSHSTCGSVTRAQSASSQTLGSSTDCSTPR EELLPSKPRSSPLPLLLPPQQLVAEATVQDLMSSLSKDPCPSHKALDPAPLAQPTPLGSV QTSPELEHRVSLFNQKNQEALPVLQINPVIHLQPTAGLEEKFRSLESKEPKLHTVPEA
Uniprot No.

Target Background

Function
Voltage-sensor protein located on the post-synaptic membrane of glutamatergic mossy fibers and granule cells in the cerebellum. Despite possessing a voltage-sensor segment, it does not form a functional ion channel; its precise function remains unclear. It undergoes both rapid and slow conformational changes in response to voltage fluctuations. A zinc-binding site regulates the slow conformational transition.
Gene References Into Functions
  1. Research has identified HVRP1, a voltage-sensing domain-containing protein predominantly expressed in the central nervous system, with high expression in cerebellar granule cells. PMID: 25165868
Database Links

KEGG: mmu:244886

UniGene: Mm.24361

Subcellular Location
Cell membrane; Multi-pass membrane protein. Cell projection, dendrite. Perikaryon.
Tissue Specificity
In brain, present in the granule layer of the cerebellar cortex. Localizes on the post-synaptic side of glutamatergic mossy fibers and granule cells in the cerebellum (at protein level).

Q&A

What is the basic structure and classification of mouse TMEM266?

Mouse Transmembrane Protein C15orf27 homolog (TMEM266) is a 538 amino acid transmembrane protein containing a voltage-sensing S1-S4 domain similar to that found in the Hv1 voltage-gated proton channel . Unlike conventional voltage-gated channels, TMEM266 has a distinct architecture with several key features:

  • N-terminus with two predicted short helices forming a compact domain

  • S1-S4 transmembrane voltage-sensing domain

  • C-terminal region containing a helical extension of the S4 helix that likely forms a coiled-coil domain

  • An additional ~250 residue C-terminal region predicted to be structurally disordered

The protein is classified as a member of the voltage-sensing domain (VSD) protein family, though it has unique properties that distinguish it from canonical voltage-gated channels. Homology modeling using Hv1 S1-S4 domain structures (PDB ID: 3WKV) and Hv1 coiled-coil domain structures (PDB IDs: 3A2A and 3VMX) has provided insights into its three-dimensional arrangement .

How is mouse TMEM266 related to other species variants?

Mouse TMEM266 shares significant sequence homology with TMEM266 proteins from other species, particularly in the conserved voltage-sensing domain. Based on available data:

  • The mouse version consists of 538 amino acids when expressed as a full-length recombinant protein

  • The human homolog (hTMEM266) contains 531 amino acids in its full-length form

  • The macaque (Macaca fascicularis) variant is shorter at 417 amino acids

This evolutionary conservation suggests important functional roles for this protein across mammalian species. The highest sequence conservation is observed in the voltage-sensing S1-S4 domain, while the C-terminal regions show greater divergence . The mouse protein is commonly used in research due to its availability as a recombinant protein and the prevalence of mouse models in neuroscience and electrophysiology studies.

What expression systems are used to produce recombinant mouse TMEM266?

Recombinant mouse TMEM266 can be produced using several expression systems, each with advantages for different experimental applications:

Expression HostTagsProtein LengthApplications
E. coliHisFull Length (1-538)Structural studies, antibody production, protein-protein interactions
HEK293DDK & MycFull LengthFunctional studies, cell-based assays, trafficking studies

For structural studies and biochemical assays, the E. coli-expressed His-tagged version provides high yields of purified protein. For functional studies requiring proper post-translational modifications, the mammalian HEK293 expression system is preferred as it ensures appropriate glycosylation and folding patterns . When designing experiments, researchers should select the appropriate expression system based on their specific research questions and downstream applications.

What electrophysiological methods are used to study TMEM266 function?

Multiple electrophysiological approaches have been employed to characterize TMEM266's function as a voltage sensor:

Voltage-clamp fluorimetry is a primary technique used to study TMEM266 conformational changes. This method involves:

  • Introducing cysteine mutations at specific positions (e.g., P194C in human TMEM266)

  • Labeling with environment-sensitive fluorophores (e.g., TAMRA-MTS)

  • Simultaneously measuring fluorescence changes and membrane potential

  • Analyzing voltage-dependent fluorescence signals that reflect protein conformational changes

Studies have revealed that hTMEM266 undergoes two distinct conformational rearrangements in response to voltage changes:

  • A rapid fluorescence change correlating with an enhanced accessibility of the fluorophore to collisional quenchers

  • A slower millisecond-timescale rearrangement that reduces TAMRA fluorescence at position P194C, observed only at voltages above 0 mV

For more complex functional studies, researchers have created chimeric constructs by transplanting the S4 helix of TMEM266 into either Hv1 or Shaker Kv channels to assess its voltage-sensing capabilities in established channel contexts .

How can TMEM266 conformational changes be monitored in real-time?

Real-time monitoring of TMEM266 conformational changes has been achieved using fluorescence-based approaches:

  • Site-specific fluorophore labeling:

    • Strategic introduction of cysteine residues at positions experiencing environmental changes during voltage sensing

    • Labeling with thiol-reactive environment-sensitive fluorophores like TAMRA-MTS

    • Measuring voltage-dependent fluorescence changes using voltage-clamp fluorimetry

  • Fluorescent protein fusions:

    • Deletion of the C-terminus and introduction of a GFP variant (super ecliptic pHluorin A227D) at the end of the S4 helix (after Q233)

    • This approach resembles the VSP-based Arclight strategy

    • Produces voltage-dependent fluorescence changes similar to TAMRA-MTS labeling but with slower kinetics

The fluorescence changes observed with both approaches typically show biphasic behavior:

  • Fast fluorescence dequenching with membrane depolarization

  • Followed by slower fluorescence quenching

  • The fast component exhibits a nearly linear ΔF/F-V relation

These techniques have revealed that TMEM266 behaves as a functional voltage sensor with distinctive conformational dynamics compared to classical voltage-gated channels.

What is the effect of zinc ions on TMEM266 function?

Extracellular zinc ions (Zn²⁺) have a significant regulatory effect on TMEM266 function, similar to their impact on the related Hv1 voltage-activated proton channel:

  • Zn²⁺ modulates the voltage-dependent conformational changes of TMEM266

  • It specifically affects the voltage-dependent fluorescence signals measured in voltage-clamp fluorimetry experiments

  • This regulation suggests conserved zinc-binding sites between TMEM266 and Hv1

The zinc sensitivity of TMEM266 has important implications:

  • It suggests evolutionary conservation of regulatory mechanisms between TMEM266 and Hv1

  • It may provide clues about TMEM266's physiological role

  • It offers a pharmacological tool for manipulating TMEM266 function in experimental settings

This zinc sensitivity provides researchers with a valuable tool for distinguishing TMEM266-mediated effects from other voltage-dependent processes in complex cellular systems.

How can homology modeling be used to understand TMEM266 structure?

Homology modeling has been crucial for understanding TMEM266 structure in the absence of direct crystallographic data. The process involves:

  • Template selection: Using the Phyre2 server and available crystal structures of the Hv1 S1-S4 domain (PDB ID: 3WKV) and Hv1 coiled-coil domain (PDB IDs: 3A2A and 3VMX) as templates

  • Model building and validation:

    • Generating a three-dimensional model of TMEM266 based on structural alignments

    • Validating the model through comparison with experimental data

    • Recognizing limitations (e.g., the Hv1 structure 3WKV is a chimeric construct, so the homology model requires cautious interpretation)

  • Secondary structure prediction:

    • Identifying key structural elements including the N-terminal domain, transmembrane segments, and C-terminal regions

    • Predicting that the C-terminus forms a helical extension of the S4 helix likely forming a coiled-coil domain

    • Determining that the ~250 residues following the coiled-coil are likely structurally disordered

These homology models provide testable hypotheses about TMEM266 structure-function relationships that can guide experimental design, including the identification of critical residues for voltage sensing and zinc interaction.

What chimeric approaches can be used to study TMEM266 voltage sensing?

Chimeric approaches have been instrumental in isolating and studying the voltage-sensing properties of TMEM266:

By transplanting the S4 helix of TMEM266 into established voltage-sensitive proteins, researchers have determined that this helix can support voltage-dependent gating when placed in appropriate contexts. Two key chimeric strategies include:

  • TMEM266-Hv1 chimeras:

    • Replacing the S4 helix in Hv1 with that from TMEM266

    • Testing whether the chimeric construct can support voltage-gated proton currents

    • Determining which specific residues are critical for voltage sensing

  • TMEM266-Shaker Kv chimeras:

    • Integrating the S4 helix from TMEM266 into Shaker potassium channels

    • Measuring voltage-dependent activation of the resulting chimeric channels

    • Assessing which aspects of voltage sensitivity are preserved

These approaches have demonstrated that the S4 helix of TMEM266 can function as a voltage sensor when placed in the appropriate context, providing strong evidence that TMEM266 contains a functional voltage-sensing domain with properties distinct from those of conventional voltage-gated channels.

What are the challenges in determining the physiological role of TMEM266?

Despite advances in characterizing TMEM266's structure and voltage-sensing properties, several challenges remain in determining its physiological role:

  • Unknown functional output:

    • Unlike Hv1 which conducts protons, or voltage-gated channels which conduct specific ions, the functional output of TMEM266's voltage sensing remains unclear

    • No intrinsic ion channel or enzyme activity has been definitively identified

  • Limited tissue expression data:

    • Comprehensive analysis of TMEM266 expression across different tissues and developmental stages is incomplete

    • Understanding where and when the protein is expressed would provide important clues to its function

  • Unknown interaction partners:

    • The C-terminal region may serve as a scaffold for protein-protein interactions

    • Identifying binding partners could reveal signaling pathways or cellular processes regulated by TMEM266

  • Technical challenges:

    • The slow conformational changes observed in electrophysiological studies suggest complex kinetics that may be difficult to study in physiological contexts

    • The protein's sensitivity to zinc complicates experiments in environments where zinc concentrations fluctuate

Future research directions should include:

  • CRISPR-mediated knockout studies to determine phenotypic effects

  • Identification of interaction partners through proteomics approaches

  • Development of specific antibodies or small-molecule modulators to probe function in native tissues

  • Investigation of potential roles in cellular processes that are influenced by membrane potential

What expression vectors and tags are optimal for TMEM266 studies?

Selecting appropriate expression vectors and tags is critical for successful TMEM266 studies. Based on available research:

Vector SystemTagLocationAdvantagesLimitations
pcDNA3.1C-terminal DYKDDDDK (FLAG)C-terminusGood expression in mammalian cells, easy detectionMay interfere with C-terminal function
pcDNA3.1HisC-terminusEfficient purification, minimal sizeLimited detection options
CustomDDK & MycC-terminusVersatile detection optionsLarger tags may impact function
CustomGFP fusion (after Q233)After S4 helixDirect visualization, functional readoutBulky tag may alter protein dynamics

For functional studies of TMEM266, careful consideration of tag position is essential. For instance:

  • The C-terminal region (following the coiled-coil domain) is predicted to be structurally disordered and may tolerate tag insertion better than structured regions

  • Insertion of tags or fluorescent proteins after transmembrane segments requires validation to ensure proper membrane topology is maintained

  • FLAG tags are advantageous for immunoprecipitation studies due to high-affinity antibodies

When designing constructs for heterologous expression, researchers should consider including a CloneEZ™ Seamless cloning approach for efficient integration into expression vectors .

How can protein-protein interactions of TMEM266 be investigated?

Investigating TMEM266 protein-protein interactions requires specialized approaches for membrane proteins:

  • Co-immunoprecipitation (Co-IP):

    • Express tagged versions of TMEM266 (e.g., FLAG-tagged or His-tagged)

    • Solubilize membranes using mild detergents (e.g., digitonin, DDM, or CHAPS)

    • Perform immunoprecipitation with tag-specific antibodies

    • Identify binding partners through mass spectrometry

  • Proximity labeling approaches:

    • Generate TMEM266 fusions with BioID or APEX2

    • These enzymes biotinylate proteins in close proximity to TMEM266

    • Purify biotinylated proteins using streptavidin

    • Identify proximal proteins by mass spectrometry

  • Yeast two-hybrid membrane systems:

    • Specialized membrane yeast two-hybrid (MYTH) systems can identify interactions

    • TMEM266 constructs must be validated for proper membrane insertion

    • Split-ubiquitin approaches may be particularly suitable

  • Fluorescence-based approaches:

    • Fluorescence resonance energy transfer (FRET) between TMEM266 and potential partners

    • Bimolecular fluorescence complementation (BiFC) to visualize interactions in living cells

When conducting these studies, researchers should be aware that the coiled-coil domain in TMEM266 likely mediates homo-oligomerization (similar to Hv1 dimers), which may complicate the interpretation of protein-protein interaction data .

What considerations are important when designing cysteine-scanning mutagenesis for TMEM266?

Cysteine-scanning mutagenesis has been valuable for studying TMEM266 conformational changes, but requires careful design:

  • Native cysteine evaluation:

    • Map all native cysteines in mouse TMEM266

    • Consider whether to create a cysteine-free background construct

    • Verify that cysteine removal doesn't disrupt protein folding or function

  • Strategic position selection:

    • Target positions predicted to undergo environmental changes during voltage sensing

    • Focus on the S4 helix and flanking regions, particularly positions facing the lipid-water interface

    • Include control positions in transmembrane segments expected to remain static

  • Methodological considerations:

    • Use thiol-specific modifying reagents (e.g., TAMRA-MTS) for fluorescence studies

    • Validate accessibility using membrane-permeant vs. impermeant reagents

    • Consider state-dependent accessibility through voltage protocols

  • Data interpretation challenges:

    • Conformational changes may affect multiple parameters (accessibility, local environment, quenching)

    • Biphasic fluorescence responses may reflect complex conformational transitions

    • Control experiments are needed to distinguish specific from non-specific effects

P194C in human TMEM266 has been particularly informative, showing distinct voltage-dependent fluorescence changes when labeled with TAMRA-MTS . Similar strategic positions should be identified in the mouse homolog based on sequence alignment and structural predictions.

How should voltage-dependent conformational changes in TMEM266 be quantified?

Quantifying voltage-dependent conformational changes in TMEM266 requires specialized analytical approaches:

  • Fluorescence-voltage (F-V) relationships:

    • Plot normalized fluorescence changes (ΔF/F) against membrane potential

    • Fit with Boltzmann functions to extract midpoint voltage (V₁/₂) and slope factors

    • For TMEM266, fast conformational changes exhibit nearly linear F-V relationships rather than sigmoidal curves typical of conventional voltage sensors

  • Time-resolved analysis:

    • Fit fluorescence time courses with exponential functions to extract kinetic parameters

    • Compare activation and deactivation time constants across different voltages

    • For TMEM266, analyze both fast and slow components separately:

      • Fast component: Immediate fluorescence changes upon voltage steps

      • Slow component: Millisecond-timescale changes observed at depolarized potentials

  • Pharmacological sensitivity analysis:

    • Quantify how modulators like zinc alter voltage-dependent parameters

    • Compare EC₅₀ values for modulation of different conformational components

    • Assess voltage-dependence of pharmacological effects

When analyzing TMEM266 data, researchers should be aware that the protein exhibits unique voltage-sensing properties distinct from classical voltage-gated channels, including linear F-V relationships and complex kinetic components that may reflect different conformational transitions.

What are the key differences between TMEM266 and conventional voltage sensors?

TMEM266 exhibits several distinctive properties that differentiate it from conventional voltage sensors:

  • Voltage-sensing characteristics:

    • Nearly linear fluorescence-voltage relationships rather than sigmoidal curves typical of conventional voltage sensors

    • Two kinetically distinct conformational changes in response to voltage changes

    • Different voltage dependencies for fast and slow conformational components

  • Structural features:

    • Contains an S1-S4 domain with similarity to Hv1

    • Lacks a conventional pore domain found in voltage-gated ion channels

    • Contains an extended C-terminal region with a predicted coiled-coil followed by a disordered region

  • Pharmacological properties:

    • Sensitivity to extracellular zinc ions, similar to Hv1

    • Unique modulatory profile that affects conformational dynamics

  • Functional output:

    • Unlike voltage-gated channels or voltage-sensitive enzymes, the functional output of TMEM266's voltage sensing remains undefined

    • Does not appear to form a functional ion channel on its own despite structural similarity to Hv1

These distinguishing features suggest that TMEM266 may represent a novel class of voltage sensors with unique physiological functions that remain to be fully characterized.

How can researchers distinguish between specific TMEM266 effects and artifacts in experimental systems?

Distinguishing genuine TMEM266 effects from experimental artifacts requires rigorous control experiments:

  • Expression level controls:

    • Titrate expression levels to ensure observed effects scale with protein abundance

    • Use inducible expression systems to compare pre- and post-induction responses

    • Implement fluorescent protein tags to correlate function with expression

  • Mutagenesis controls:

    • Create non-functional mutants by neutralizing key charged residues in the S4 helix

    • Verify that voltage-dependent effects are abolished in these mutants

    • Use chimeric constructs to isolate domain-specific functions

  • Pharmacological verification:

    • Exploit zinc sensitivity to validate TMEM266-specific effects

    • Demonstrate dose-dependent modulation by zinc

    • Show that zinc effects are eliminated by mutating predicted zinc-binding sites

  • Heterologous expression system considerations:

    • Compare results across different cell types to rule out cell-specific artifacts

    • Use patch-clamp fluorimetry to correlate optical signals with membrane potential

    • Control for endogenous voltage-dependent processes in expression systems

For fluorescence-based studies, additional controls should include:

  • Unlabeled controls to assess autofluorescence

  • Fluorophore-only controls to rule out direct voltage effects on the fluorophore

  • Spectral analysis to confirm signals originate from the intended fluorophore

By implementing these rigorous controls, researchers can confidently attribute observed effects to TMEM266 function rather than experimental artifacts.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.