Recombinant Mouse Transmembrane protein C16orf54 homolog

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized preparation.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50%, which may serve as a reference.
Shelf Life
Shelf life depends on various factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is essential for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
If you require a specific tag type, please inform us; we will prioritize its development.
Synonyms
Transmembrane protein C16orf54 homolog
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-225
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Protein Sequence
MPVTPQQPSGHTEGLPEPTAEAAVWVVIPCGPCIPIMLGLASLTAFFIITTAVLAERLFR RPQPDPSQRAPTLVWRPGGELWIEPTSSARERSEDWYGSSMPLLMDRAPGPPTPGGTLEG RATAPPATSAPYSSLSSLVPQTPPEVPAQSTFWRPQTQEERPHDTSLVSWVGSEPMPEAG LQVGSPRPWRPRQGSLEPDWGLQPRVTLEQISAFWKREGRTSVGF
Uniprot No.

Target Background

Gene References Into Functions
  1. AI467606, a novel transcriptional target of RUNX1/AML1, is identified as being extensively expressed within the hematopoietic system during early hematopoietic development. PMID: 21498670
Database Links

KEGG: mmu:101602

UniGene: Mm.490357

Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is the basic structure and sequence of Mouse Transmembrane protein C16orf54 homolog?

Mouse Transmembrane protein C16orf54 homolog (Q8C708) is a full-length protein consisting of 225 amino acids. The sequence is: MPVTPQQPSGHTEGLPEPTAEAAVWVVIPCGPCIPIMLGLASLTAFFIITTAVLAERLFRRPQPDPSQRAPTLVWRPGGELWIEPTSSARERSEDWYGSSMPLLMDRAPGPPTPGGTLEGRATAPPATSAPYSSLSSLVPQTPPEVPAQSTFWRPQTQEERPHDTSLVSWVGSEPMPEAGLQVGSPRPWRPRQGSLEPDWGLQPRVTLEQISAFWKREGRTSVGF . This protein is predicted to be an integral component of the cell membrane with multiple transmembrane domains .

How is the recombinant form of this protein typically produced for research?

The recombinant Mouse Transmembrane protein C16orf54 homolog is commonly produced in E. coli expression systems with an N-terminal His tag . The protein is expressed as a full-length construct (amino acids 1-225) and purified to greater than 90% purity as determined by SDS-PAGE . Some variations may include additional C-terminal tags, with tag types determined based on tag-protein stability considerations .

What are the typical physical properties of purified recombinant C16orf54 homolog?

The purified protein is commonly available as a lyophilized powder with a molecular weight of approximately 24,532 Da . When properly reconstituted, it should have a purity greater than 90% as determined by SDS-PAGE . The protein can be reconstituted in deionized sterile water to a concentration of 0.1-1.0 mg/mL, and addition of 5-50% glycerol (final concentration) is recommended for long-term storage .

What expression systems are most effective for producing functional C16orf54 homolog?

While E. coli is the most commonly reported expression system for Mouse C16orf54 homolog , the protein may also be expressed in yeast, baculovirus, or mammalian cell systems depending on experimental requirements and downstream applications . E. coli systems offer cost-effectiveness and high yield, but may not incorporate post-translational modifications that might be present in the native protein.

How can I optimize protein yield and solubility when expressing recombinant C16orf54?

For transmembrane proteins like C16orf54 homolog, optimizing expression conditions is crucial for improving yield and solubility. Methodological approaches include: (1) testing different E. coli strains optimized for membrane protein expression; (2) varying induction temperatures (typically lower temperatures of 16-25°C improve solubility); (3) adjusting inducer concentrations; and (4) using solubility-enhancing fusion tags in addition to the His tag. For membrane proteins specifically, addition of mild detergents during lysis and purification is often necessary to maintain protein solubility and native conformation.

What are the optimal storage conditions for maintaining C16orf54 homolog stability?

For long-term storage, store the protein at -20°C or -80°C . Working aliquots can be stored at 4°C for up to one week, but repeated freeze-thaw cycles should be avoided as they can compromise protein integrity . The recommended storage buffer is Tris/PBS-based buffer with 6% Trehalose at pH 8.0 . For reconstituted protein, adding glycerol to a final concentration of 5-50% (with 50% being standard) before aliquoting can help maintain stability during freeze-thaw cycles .

How should researchers reconstitute and handle lyophilized C16orf54 protein to maximize experimental consistency?

Prior to opening the vial, briefly centrifuge to bring the contents to the bottom . Reconstitute the lyophilized protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL . After reconstitution, add glycerol to a final concentration of 5-50% before creating single-use aliquots for storage at -20°C/-80°C . This approach minimizes freeze-thaw cycles and maintains protein stability. For sensitive applications, filter sterilization after reconstitution may be necessary .

What experimental techniques are suitable for studying C16orf54 protein-protein interactions?

For investigating protein-protein interactions involving C16orf54 homolog, consider employing: (1) co-immunoprecipitation using the His tag; (2) yeast two-hybrid screening; (3) pull-down assays; (4) protein microarrays; or (5) surface plasmon resonance. Based on studies of related proteins, techniques that preserve membrane protein integrity, such as detergent-solubilized co-immunoprecipitation or cell-based proximity ligation assays, may be particularly effective for transmembrane proteins like C16orf54 homolog.

How can functional assays be designed to assess the biological role of C16orf54 in immune contexts?

Given the evidence that C16orf54 is expressed in immune-related tissues and may have immune functions , functional assays could include: (1) immune cell migration assays after C16orf54 knockdown or overexpression; (2) cytokine production measurements in response to C16orf54 modulation; (3) assessment of lymphocyte activation markers; and (4) co-culture systems to evaluate immune cell interactions. Researchers should consider examining expression correlation with stromal, immune, and ESTIMATE scores as shown in previous studies, which found significant positive correlations with these immune indicators .

What is known about the conservation between mouse and human C16orf54?

The mouse Transmembrane protein C16orf54 homolog shares significant sequence and structural similarities with the human C16orf54 protein. The human ortholog is located on chromosome 16p11.2 , while homologs have been identified in various species including Macaca mulatta (Rhesus monkey) . Comparative sequence analysis should be performed to determine precise conservation levels and functional domains that might indicate evolutionarily preserved roles.

How is C16orf54 implicated in human diseases and what experimental models exist to study these associations?

Human C16orf54 has been potentially associated with several conditions including Spondylocostal Dysostosis 5 and Spondyloepimetaphyseal Dysplasia With Joint Laxity . Additionally, research indicates its potential as a prognostic, diagnostic, and immune marker across various cancers . Experimental models to study these associations include: (1) mouse knockdown/knockout models focusing on phenotypes related to these conditions; (2) cell line models with C16orf54 modulation to study signaling pathways; and (3) patient-derived xenografts for studying cancer-related functions.

What signaling pathways have been associated with C16orf54 function?

Expression of C16orf54 has been closely linked to immune cell signaling pathways, as revealed by KEGG analysis and Gene Set Enrichment Analysis (GSEA) . Research has shown significant correlations between C16orf54 expression and tumor immune microenvironment (TIME) factors, including stromal, immune, and ESTIMATE scores . Additionally, C16orf54 expression shows negative correlation with tumor purity in most cancers, further supporting its potential role in immune-related processes .

How can researchers effectively study genetic interactions between C16orf54 and other genes in developmental contexts?

To study genetic interactions involving C16orf54, researchers can employ methodologies similar to those used for studying 16p12.1 homologs: (1) Systematic pairwise knockdown/knockout approaches in model organisms like Drosophila or Xenopus; (2) Quantitative phenotyping using sensitive measures (e.g., Flynotyper for Drosophila eye phenotypes); (3) Application of mathematical models (like the multiplicative model) to calculate interaction scores; and (4) Tissue-specific knockdown to evaluate context-dependent effects . These approaches can help identify both synergistic and antagonistic interactions between C16orf54 and other genes.

What approaches are recommended for investigating the role of C16orf54 in tumor heterogeneity and immune infiltration?

Advanced research into C16orf54's role in tumor heterogeneity could employ: (1) Single-cell RNA sequencing to analyze expression patterns across tumor cell populations; (2) Spatial transcriptomics to examine expression in relation to tumor microenvironment; (3) Correlation studies between C16orf54 expression and tumor mutation burden (TMB) or microsatellite instability (MSI); and (4) Analysis of relationships with DNAss and RNAss tumor stemness indicators . For immune infiltration studies, researchers should consider examining correlations between C16orf54 expression and specific immune cell populations using established tools like TIMER2.0 .

What are the technical challenges in studying the membrane topology and post-translational modifications of C16orf54?

Studying membrane topology of C16orf54 presents several technical challenges: (1) Maintaining protein in its native conformation during extraction and purification; (2) Distinguishing between multiple transmembrane domains; and (3) Identifying orientation relative to the membrane. Methodologies to address these challenges include: epitope insertion followed by selective permeabilization immunofluorescence, protease protection assays, and glycosylation mapping experiments. For post-translational modifications, mass spectrometry-based approaches comparing E. coli-expressed protein (lacking most modifications) with protein expressed in mammalian systems can identify functionally relevant modifications.

How can advanced genetic techniques be used to study the function of C16orf54 in development and disease?

Advanced genetic approaches for studying C16orf54 function include: (1) CRISPR/Cas9-mediated genome editing to create precise mutations or conditional knockouts; (2) BAC transgenics to study expression patterns with endogenous regulatory elements; (3) Tissue-specific and inducible expression systems to examine temporal requirements; and (4) Humanized mouse models expressing human C16orf54 to study disease-relevant functions. When employing these techniques, researchers should consider the importance of genetic background and potential compensatory mechanisms that may mask phenotypes in complete knockout models.

What critical controls should be included when performing knockdown/overexpression studies of C16orf54?

For robust C16orf54 functional studies, essential controls include: (1) Multiple knockdown approaches (siRNA, shRNA, CRISPR) to rule out off-target effects; (2) Rescue experiments using RNAi-resistant constructs to confirm specificity; (3) Dose-response validation with varying levels of knockdown/overexpression; (4) Tissue/cell type-matched controls to account for context-dependent functions; and (5) Temporal controls when studying developmental processes. Quantitative validation of knockdown/overexpression efficiency at both mRNA and protein levels should be performed for all experimental conditions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.