Recombinant Mouse Transmembrane protein C19orf77 homolog

Shipped with Ice Packs
In Stock

Description

Gene and Protein Overview

ParameterMouse Homolog (2210404O07Rik)Human Ortholog (C19orf77/SMIM24)
Gene ID72273 (NCBI) 284422 (NCBI)
Accession NumberNM_001099917.1 NM_001136503.2
Protein LengthNot explicitly stated130 amino acids (human)
AliasesTransmembrane Protein HSPC323 SMIM24, HSPC323, C19orf77
Chromosomal LocationMouse genome (exact scaffold not specified) Human Chromosome 19

The mouse protein is part of a conserved gene family, with C19orf77 orthologs identified in multiple species, including bowhead whales (59.82% protein identity) . In humans, SMIM24 is a small integral membrane protein with two transmembrane domains, suggesting a role in membrane-associated signaling or transport .

Transmembrane Topology

The human SMIM24 protein contains two transmembrane helices (aa 52–99 and 101–130) , which are critical for its localization to cellular membranes. While the mouse homolog’s exact structure is not experimentally validated, sequence homology (44–50% identity with human) implies a similar topology.

Functional Predictions

  • Membrane Signaling: Potential involvement in receptor-mediated signaling due to its transmembrane domains.

  • Cellular Transport: Possible role in ion or molecule transport, though direct evidence is lacking.

  • Cancer Biology: Human C19orf77 is downregulated in B-cell acute lymphoblastic leukemia (B-ALL), suggesting a tumor suppressor role .

CRISPR Knockout Tools

A recombinant CRISPR-Cas9 system targeting 2210404O07Rik is available for gene knockout studies in mice. This AAV vector set includes:

  • saCas9 (Streptococcus pyogenes Cas9 variant) for efficient gene editing.

  • Three sgRNA sequences to induce frameshift mutations in exonic regions .

  • Vector Map: pAAV-PGK-saCas9-U6-sgRNAsa-hGH-amp .

Vector FeatureDetail
Expression SystemAll-in-one AAV vector (Cas9 + sgRNA)
Target ValidationRestriction enzyme digest and sequencing
Species SpecificityMouse

siRNA Knockdown Tools

While siRNA vectors for human C19orf77 are commercially available (e.g., AAV-siRNA pooled vectors ), no mouse-specific siRNA tools are explicitly documented in the provided sources.

Human C19orf77 (SMIM24) Insights

  1. Cancer Association:

    • C19orf77 expression is reduced in B-cell ALL, as shown by microarray and RT-qPCR studies .

    • In B-cell ALL cell lines (e.g., BV173, Sup-B15), CSRP2 and COL5A1 are upregulated, while C19orf77 remains unchanged, suggesting context-dependent regulation .

  2. Orthologous Expression:

    • Bowhead whale C19orf77 orthologs show 72.02% cDNA identity with human, with a Ka/Ks ratio of 0.52962, indicating purifying selection .

Challenges and Future Directions

  1. Lack of Recombinant Protein Availability:
    While human SMIM24 recombinant fragments are available (e.g., aa 52–99 and 101–130) , no commercial recombinant mouse protein is documented. This limits direct biochemical studies.

  2. Functional Validation: Further research is needed to confirm the mouse protein’s role in membrane signaling, transport, or disease.

Product Specs

Form
Lyophilized powder
Note: While we strive to ship the format currently in stock, we understand you may have specific needs. Please indicate your desired format during order placement, and we will accommodate your request to the best of our ability.
Lead Time
Delivery time may vary depending on the purchasing method and location. Please consult your local distributors for specific delivery timelines.
Note: All our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance, as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. For optimal usage, store working aliquots at 4°C for up to one week.
Reconstitution
We recommend centrifuging the vial briefly before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We suggest adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard final concentration of glycerol is 50%, which can serve as a reference for your use.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer composition, temperature, and the inherent stability of the protein.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms typically have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
The tag type is determined during the manufacturing process.
We strive to select the most appropriate tag type for your protein. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag if feasible.
Synonyms
Smim24; Small integral membrane protein 24
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
21-120
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Smim24
Target Protein Sequence
QQASERRLKPWLVGLAAVVGFLFIVFILMLANRVWCAKGRAEDEEATFRMEHIMNENSQP SKADKKQKKKVDRKGGQSNEALELEEKESSDEERGKKTAL
Uniprot No.

Target Background

Database Links

KEGG: mmu:72273

UniGene: Mm.253147

Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is the Mouse Transmembrane protein C19orf77 homolog and what are its key genetic identifiers?

The Mouse Transmembrane protein C19orf77 homolog is encoded by the gene 2210404O07Rik (NCBI Gene ID: 72273, Accession Number: NM_001099917.1). It is classified as a transmembrane protein homologous to the human C19orf77 protein, also known as transmembrane protein HSPC323 homolog . The protein contains hydrophobic domains spanning cellular membranes, with portions extending into both cytoplasmic and extracellular spaces. Experimental characterization using hydropathy analyses, protease protection assays, and structural studies would be necessary to determine the exact number and arrangement of transmembrane domains.

What experimental approaches are most effective for studying the subcellular localization of Mouse C19orf77 homolog?

For effective subcellular localization studies, employ a multi-method approach:

  • Confocal immunofluorescence microscopy using validated antibodies against 2210404O07Rik combined with organelle markers (ER, Golgi, plasma membrane)

  • Cell fractionation followed by Western blot analysis to quantify protein distribution between membrane fractions

  • Live-cell imaging using CRISPR knock-in of fluorescent tags (GFP, mCherry) at the C-terminus of endogenous 2210404O07Rik

  • Super-resolution microscopy (STORM, PALM) for high-precision localization within membrane microdomains

  • Electron microscopy with immunogold labeling for ultrastructural localization

When optimizing immunofluorescence protocols, test multiple fixation methods (4% paraformaldehyde, methanol, glutaraldehyde) as transmembrane proteins often require specific conditions for epitope preservation and accessibility.

How can CRISPR-Cas9 technology be optimally applied to study 2210404O07Rik gene function?

For CRISPR-based functional studies of 2210404O07Rik, the All-in-one AAV vector system with saCas9 offers several methodological advantages . This system uses Staphylococcus aureus Cas9 (smaller than Streptococcus pyogenes Cas9) making it suitable for AAV packaging.

Implementation protocol:

  • Select vector: pAAV-PGK-saCas9-U6-sgRNAsa-hGH-amp with three sgRNA targets designed for exonic regions of 2210404O07Rik

  • Validate sgRNA efficiency in cell lines using T7 Endonuclease I assay before in vivo application

  • Deliver AAV particles at optimal MOI (typically 100-1000 viral particles per cell)

  • Confirm knockout efficiency by:

    • Genomic DNA sequencing across target sites

    • RT-qPCR to verify mRNA reduction

    • Western blot to confirm protein elimination

  • Perform clonal selection to establish homogeneous knockout cell lines

  • Conduct rescue experiments by reintroducing wild-type 2210404O07Rik to confirm phenotype specificity

What are the comparative advantages of different viral vector systems for 2210404O07Rik genetic manipulation?

The selection of viral vector significantly impacts experimental outcomes when manipulating 2210404O07Rik:

Vector SystemConcentration UnitsTransduction EfficiencyCell Division DependencyExpression DurationAdvantages for 2210404O07Rik Research
AAVGC/mL (genome copies/mL)Very high (~100%)IndependentLong-term, non-integratingEfficient transduction of both dividing and non-dividing cells; lower immunogenicity; ideal for in vivo studies
LentivirusCFU/mL (colony-forming units/mL)Moderate to highIndependentStable integrationSuitable for generating stable cell lines with permanent 2210404O07Rik modification; larger insert capacity than AAV
RetrovirusCFU/mLModerateDependent (dividing cells only)Stable integrationUseful for proliferating cells; simpler vector design
AdenovirusPFU/mL (plaque-forming units/mL)Extremely high (~100%)IndependentTransient (~7 days)Highest transduction efficiency; ideal for short-term, high-expression studies

For most 2210404O07Rik functional studies, AAV vectors offer an optimal balance of efficiency, long-term expression, and safety profile, particularly when delivering CRISPR components.

How can researchers differentiate between splice variants of 2210404O07Rik in experimental samples?

To accurately differentiate and quantify potential splice variants of 2210404O07Rik:

  • Design isoform-specific RT-qPCR assays:

    • Create primers spanning unique exon-exon junctions

    • Optimize annealing temperatures using gradient PCR

    • Validate specificity using synthetic templates of each isoform

  • Employ RNA-seq analysis with specialized computational pipelines:

    • Use algorithms specifically designed for isoform quantification (RSEM, Salmon)

    • Apply sufficient sequencing depth (>30M reads per sample)

    • Validate novel junctions with targeted RT-PCR

  • Perform long-read sequencing (PacBio or Oxford Nanopore):

    • Sequence full-length transcripts to unambiguously identify isoforms

    • Use targeted approaches like PCR-cDNA sequencing for focused analysis

  • Validate protein isoforms:

    • Develop isoform-specific antibodies targeting unique regions

    • Use Western blotting with appropriate controls for each variant

    • Consider immunoprecipitation followed by mass spectrometry for unbiased detection

What epigenetic methodologies are most effective for studying 2210404O07Rik regulation?

For comprehensive epigenetic analysis of 2210404O07Rik regulation:

  • DNA methylation profiling:

    • Apply Illumina's Infinium Methylation EPIC BeadChip assay to quantify methylation at relevant CpG sites

    • Calculate beta values as the ratio of methylated signals to total signals (range: 0-1)

    • Identify significant methylation differences using statistical thresholds:

      • Coefficient of variation <20% in control samples

      • Absolute difference in methylation (Δβ) >0.05 between conditions

    • Correct for cell-type heterogeneity using computational algorithms like EpiDISH

  • Histone modification analysis:

    • Perform ChIP-seq targeting key modifications:

      • H3K4me3 (active promoters)

      • H3K27ac (active enhancers)

      • H3K27me3 (repressive marks)

    • Create enhancer-promoter interaction maps using Hi-C or ChIA-PET

    • Integrate with expression data to correlate chromatin state with transcription

  • Transcription factor binding analysis:

    • Identify relevant transcription factors through motif analysis

    • Perform ChIP-seq for candidate factors (consider factors mentioned in T-cell development research like TCF1, RUNX1, and GATA3)

    • Use CUT&RUN or CUT&TAG for higher resolution of binding sites

How might researchers investigate the potential role of 2210404O07Rik in T-cell development?

To systematically evaluate 2210404O07Rik's involvement in T-cell development:

  • Establish baseline expression profile:

    • Analyze 2210404O07Rik expression across T-cell developmental stages using flow cytometry-sorted thymocyte populations:

      • DN1-DN4 (CD4-CD8- double-negative stages)

      • DP (CD4+CD8+ double-positive)

      • SP (CD4+ or CD8+ single-positive)

    • Compare with established T-cell development markers (CD7, CD5, CD1a)

  • In vitro developmental assays:

    • Employ the OP9-DL1 co-culture system for controlled T-cell differentiation studies :

      • Isolate CD34+ hematopoietic stem cells (HSCs)

      • Culture on OP9 stromal cells expressing Delta-like 1 ligand

      • Monitor progression through T-cell developmental stages

      • Assess effects of 2210404O07Rik manipulation on differentiation kinetics

    • Perform CRISPR knockout of 2210404O07Rik in HSCs using the AAV-saCas9 system

    • Evaluate impacts on:

      • TCR rearrangement sequencing (TCR-δ, TCR-γ, TCR-β, TCR-α)

      • Lineage commitment (αβ vs. γδ T-cell fate)

      • Expression of stage-specific markers

  • In vivo developmental studies:

    • Transplant 2210404O07Rik-modified HSCs into immunodeficient mouse models (NOD/SCIDγc−/− or Rag2−/−γc−/−)

    • Analyze thymic development by flow cytometry and histology

    • Assess peripheral T-cell populations and functionality

How does NOTCH signaling potentially interact with 2210404O07Rik function in T-lymphopoiesis?

To investigate potential NOTCH-2210404O07Rik interactions in T-cell development:

  • Expression correlation analysis:

    • Compare 2210404O07Rik expression with NOTCH pathway activity:

      • In OP9-DL1 (NOTCH ligand-expressing) versus control OP9 co-cultures

      • Following γ-secretase inhibitor treatment to block NOTCH signaling

      • In cells expressing constitutively active NOTCH intracellular domain (NICD)

  • Genetic interaction studies:

    • Perform epistasis analysis in the OP9-DL1 system:

      • Generate 2210404O07Rik knockout using CRISPR-Cas9

      • Assess impact on NOTCH target genes (HES1, HEY1, DTX1)

      • Test whether NICD overexpression rescues 2210404O07Rik knockout phenotypes

  • Molecular interaction analysis:

    • Investigate physical interactions:

      • Co-immunoprecipitation of 2210404O07Rik with NOTCH receptors or pathway components

      • Proximity ligation assay for in situ interaction detection

      • Domain mapping to identify specific interaction interfaces

  • Signaling pathway analysis:

    • Quantify effects of 2210404O07Rik manipulation on NOTCH-dependent developmental decisions:

      • αβ versus γδ T-cell fate determination

      • Expression of BCL11B, a key NOTCH-regulated T-cell commitment factor

      • TCR rearrangement timing and efficiency

What strategies overcome challenges in generating stable cell lines expressing 2210404O07Rik?

For optimized stable expression of potentially challenging transmembrane proteins:

  • Vector design considerations:

    • Use expression vectors with moderate promoters (CMV, EF1α) to avoid toxicity from overexpression

    • Include purification tags positioned to avoid disrupting transmembrane domains

    • Consider inducible expression systems (Tet-On/Off) to control expression levels

  • Cell line selection optimization:

    • Test multiple cell backgrounds (HEK293, CHO, Jurkat)

    • For T-cell studies, compare expression in immature (Jurkat) versus mature (primary T-cells) lineages

    • Evaluate growth characteristics and expression stability over multiple passages

  • Transfection/transduction protocol refinement:

    • For lentiviral delivery:

      • Optimize vector concentration (300-1000 ng p24/mL)

      • Test polybrene (2-10 μg/mL) to enhance membrane fusion

      • Use spinoculation (800-1200 g for 90 minutes) to increase efficiency

    • For AAV delivery:

      • Calculate optimal vector genome copies (1000-10000 GC/cell)

      • Evaluate different AAV serotypes for target cell tropism

  • Selection strategy:

    • Implement dual selection methods (antibiotic resistance plus fluorescent marker)

    • Perform single-cell sorting to establish clonal populations

    • Validate expression using multiple methods (Western blot, flow cytometry, RT-qPCR)

How can researchers optimize the detection of endogenous 2210404O07Rik protein in tissue samples?

To enhance detection sensitivity for potentially low-abundance transmembrane proteins:

  • Tissue preparation optimization:

    • Test multiple fixation protocols:

      • Paraformaldehyde (2-4%) for morphology preservation

      • Methanol for certain transmembrane epitopes

      • Combined protocols with gentler fixatives like DSP (dithiobis-succinimidyl propionate)

    • Optimize antigen retrieval:

      • Test heat-induced (citrate buffer, pH 6.0; EDTA buffer, pH 9.0)

      • Enzymatic methods (proteinase K, trypsin)

      • Combination approaches for maximum epitope exposure

  • Advanced detection technologies:

    • Apply signal amplification methods:

      • Tyramide signal amplification (increases sensitivity 10-50 fold)

      • Quantum dot secondary antibodies for improved signal-to-noise ratio

      • RNAscope for highly sensitive mRNA detection when protein detection is challenging

  • Validation controls:

    • Use tissues from 2210404O07Rik knockout models as negative controls

    • Include tissues with confirmed high expression as positive controls

    • Employ multiple antibodies targeting different epitopes for confirmation

  • Sample enrichment strategies:

    • Perform membrane fraction isolation before Western blot analysis

    • Use immunoprecipitation to concentrate target protein

    • Consider proximity labeling approaches (BioID, APEX) for associated protein complex isolation

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.