Recombinant Mouse Transmembrane protein C1orf162 homolog

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs unless dry ice is requested. Please contact us in advance for dry ice shipping; additional fees will apply.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to consolidate contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50%, which can be used as a reference.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized formulations have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type is determined during the manufacturing process.
The specific tag type is determined during production. If a specific tag is required, please inform us; we will prioritize development according to your specification.
Synonyms
Transmembrane protein C1orf162 homolog
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-132
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Protein Sequence
MGSTSSTPKSTICTFSTTAPVTSSTPYFFNPKKEHIILAFFAGVLLTLLIVALIFLIVKS CRKCHSSAQTQDPPSEPPTKLSSLSKESLTYASMTFKPPEENSNDLTRNHSSGLEPTIYS QIKVTDSDLPLP
Uniprot No.

Target Background

Database Links

KEGG: mmu:433638

UniGene: Mm.239081

Subcellular Location
Membrane; Single-pass membrane protein.

Q&A

What is the basic structural and molecular characterization of Mouse Transmembrane Protein C1orf162 homolog?

Mouse Transmembrane Protein C1orf162 homolog is a protein-coding gene product consisting of 132 amino acids in its full-length form. The protein contains transmembrane domains consistent with its classification as a membrane protein. The gene encodes a protein that is homologous to the human C1orf162 gene product, with the mouse version being expressed from a chromosome that has not been definitively mapped (hence "chromosome unknown") .

The protein is available as a recombinant product with a C-terminal histidine tag when expressed in E. coli expression systems. The gene has two identified mRNA variants (XM_019627446.1 and XM_019627447.1) with corresponding protein accessions XP_019482991.1 and XP_019482992.1 . The complete open reading frame (ORF) is 402 base pairs in length, suggesting a relatively small protein product .

Are there any known post-translational modifications of Mouse C1orf162 homolog that affect its function?

While the specific post-translational modifications of Mouse C1orf162 homolog have not been extensively characterized in the available literature, as a transmembrane protein, it may undergo modifications common to this protein class. These potentially include:

  • N-linked or O-linked glycosylation, which could affect protein folding, stability, and interaction capabilities

  • Phosphorylation at serine, threonine, or tyrosine residues, which might regulate protein activity or interactions

  • Ubiquitination, which could control protein turnover and degradation pathways

Researchers working with recombinant versions should be aware that E. coli-expressed proteins (as indicated in the available product information) lack the eukaryotic post-translational modification machinery, which may affect protein functionality compared to the native form . For studies requiring properly modified protein, mammalian expression systems may be preferable, although these are not explicitly mentioned in the available product listings.

What expression systems are optimal for producing functional Recombinant Mouse C1orf162 homolog?

The choice of expression system should be guided by the intended application. For structural studies or antibody production, E. coli-derived protein may be sufficient. For functional studies, especially those investigating protein-protein interactions or signaling, mammalian systems might yield more biologically relevant material.

What are the recommended protocols for purification of Recombinant Mouse C1orf162 homolog?

Purification of Recombinant Mouse C1orf162 homolog with a histidine tag typically follows these methodological steps:

  • Cell lysis optimization: For transmembrane proteins, detergent selection is critical. Start with a panel including mild detergents like n-dodecyl-β-D-maltoside (DDM), n-octyl-β-D-glucopyranoside (OG), or digitonin.

  • Immobilized metal affinity chromatography (IMAC):

    • Equilibrate Ni-NTA or cobalt resin with binding buffer containing the selected detergent

    • Apply clarified lysate

    • Wash extensively to remove non-specific binding

    • Elute with imidazole gradient or step elution (typically 250-300 mM imidazole)

  • Size exclusion chromatography (SEC): Further purify the IMAC-purified protein using SEC to remove aggregates and obtain homogeneous protein.

  • Protein quality assessment:

    • SDS-PAGE for purity

    • Western blot for identity confirmation

    • Dynamic light scattering for homogeneity

For recombinant Mouse C1orf162 homolog specifically, researchers should note that the protein length is relatively short (132 amino acids), which may influence its behavior during purification . The presence of transmembrane domains necessitates maintaining an appropriate detergent concentration throughout purification to prevent aggregation.

How can researchers validate the activity of Recombinant Mouse C1orf162 homolog?

  • Structural integrity assessment:

    • Circular dichroism (CD) spectroscopy to confirm secondary structure content

    • Thermal shift assays to evaluate protein stability

    • Limited proteolysis to assess proper folding

  • Binding partner identification and validation:

    • Pull-down assays using the His-tagged protein as bait

    • Surface plasmon resonance (SPR) or bio-layer interferometry (BLI) to quantify binding to potential partners

    • Crosslinking mass spectrometry to identify proximal proteins in a complex

  • Functional reconstitution:

    • Incorporation into liposomes or nanodiscs to restore membrane environment

    • Assays for potential channel or transporter activity

    • Cell-based assays measuring changes in signaling upon protein introduction

Given the transmembrane nature of the protein, reconstitution into a membrane-like environment may be critical for observing native functionality. Comparative analysis with the human ortholog, which may have more annotated functions, could provide direction for designing appropriate activity assays.

What are potential interacting partners of Mouse C1orf162 homolog based on current research?

While specific interacting partners of Mouse C1orf162 homolog are not explicitly documented in the available search results , researchers can employ several strategies to identify potential binding partners:

  • Bioinformatic prediction approaches:

    • Sequence-based predictions of protein-protein interaction motifs

    • Homology modeling based on human C1orf162 interactome

    • Analysis of co-expression patterns across tissues

  • Experimental identification methods:

    • Proximity labeling methods (BioID, APEX) in relevant cell types

    • Co-immunoprecipitation coupled with mass spectrometry

    • Yeast two-hybrid screening with the non-transmembrane domains

  • Validation of predicted interactions:

    • Co-localization studies in relevant cell types

    • FRET/BRET analysis for direct interaction assessment

    • Mutational analysis of binding interfaces

The absence of documented interacting partners in current databases suggests this represents an open area for research. Investigators should consider employing multiple complementary approaches to build confidence in newly identified interactions.

How does Mouse C1orf162 homolog compare structurally and functionally to the human ortholog?

Comparative analysis between mouse and human C1orf162 proteins reveals important considerations for translational research:

Structural comparison:
The mouse C1orf162 homolog consists of 132 amino acids in its full-length form, while detailed sequence comparison with the human ortholog requires additional analysis not provided in the available search results . Transmembrane topology prediction would likely reveal similar membrane-spanning regions between the orthologs, though specific differences in extracellular or cytoplasmic domains may exist.

  • Potential differences in tissue expression patterns between mouse and human

  • Species-specific interaction partners that may affect signaling outcomes

  • Distinctions in regulatory mechanisms controlling expression or localization

For researchers using mouse models to study human disease relevance, validating functional conservation through complementation studies (e.g., expressing mouse protein in human cells lacking C1orf162) would provide evidence of functional equivalence.

What experimental approaches are recommended for studying the subcellular localization of C1orf162 homolog?

Determining the precise subcellular localization of C1orf162 homolog is critical for understanding its function. Researchers should consider these methodological approaches:

  • Fluorescent protein fusion approaches:

    • Generate C- and N-terminal GFP/mCherry fusions and express in relevant cell types

    • Validate that tags don't disrupt transmembrane topology or trafficking

    • Compare localization patterns to established organelle markers

  • Immunofluorescence microscopy:

    • Develop or acquire specific antibodies against C1orf162 homolog

    • Use super-resolution techniques (STED, STORM) for precise localization

    • Perform co-localization studies with markers for plasma membrane, ER, Golgi, or vesicular compartments

  • Biochemical fractionation:

    • Perform subcellular fractionation of tissues expressing C1orf162

    • Analyze fractions by Western blot to determine enrichment

    • Compare distribution to known markers of different membrane compartments

  • Electron microscopy approaches:

    • Immunogold labeling for ultrastructural localization

    • Correlative light and electron microscopy for contextualization

The transmembrane nature of the protein suggests it will localize to membranes, but determining the specific membrane system(s) will provide crucial insights into potential functions.

What tissue-specific expression patterns have been observed for Mouse C1orf162 homolog?

While the provided search results don't contain specific information about tissue expression patterns of Mouse C1orf162 homolog, researchers can employ several approaches to characterize its expression:

  • Transcriptomic analysis:

    • Mining publicly available RNA-seq datasets across mouse tissues

    • Quantitative RT-PCR analysis of tissue panels

    • Single-cell RNA-seq to identify specific cell types expressing the gene

  • Protein-level validation:

    • Western blot analysis of tissue lysates

    • Immunohistochemistry on tissue sections

    • Flow cytometry for cell-type specific expression

  • Reporter gene approaches:

    • Generation of knock-in mice with fluorescent reporters

    • Analysis of promoter activity in cell culture models

Understanding tissue-specific expression patterns would provide valuable context for functional studies and may suggest physiological processes in which C1orf162 participates.

What are common challenges in expressing and purifying Recombinant Mouse C1orf162 homolog and how can they be addressed?

Researchers working with Recombinant Mouse C1orf162 homolog may encounter several technical challenges during expression and purification:

Challenge 1: Low expression levels

  • Solutions:

    • Optimize codon usage for the expression host

    • Test different promoter strengths and induction conditions

    • Consider fusion partners that enhance expression (e.g., SUMO, MBP)

    • Evaluate different E. coli strains (BL21, Rosetta, C41/C43 for membrane proteins)

Challenge 2: Protein insolubility and inclusion body formation

  • Solutions:

    • Lower induction temperature (16-20°C)

    • Reduce inducer concentration

    • Add detergents during lysis (screening panel recommended)

    • Consider refolding protocols if inclusion bodies form

    • Test insect or mammalian expression systems

Challenge 3: Protein degradation

  • Solutions:

    • Add protease inhibitors during all purification steps

    • Optimize buffer conditions (pH, salt concentration)

    • Maintain samples at 4°C throughout purification

    • Consider adding stabilizing agents (glycerol, specific lipids)

Based on the available commercial preparation, E. coli expression has been successful for this protein , suggesting that bacterial expression can work despite the transmembrane nature of the protein. The His-tag approach has proven effective for affinity purification.

What controls should be included in functional experiments using Recombinant Mouse C1orf162 homolog?

Rigorous experimental design for functional studies of Recombinant Mouse C1orf162 homolog should include these methodological controls:

  • Negative controls:

    • Buffer-only conditions to establish baseline measurements

    • Irrelevant protein of similar size/tag to control for non-specific effects

    • Heat-denatured C1orf162 homolog to confirm activity requires native structure

  • Positive controls:

    • When possible, a protein with known activity in the assay system

    • Human ortholog for comparative studies

    • If function is known, a validated active variant

  • Validation controls:

    • Multiple protein preparations to ensure reproducibility

    • Concentration-dependent responses to establish specificity

    • Mutational analysis targeting predicted functional domains

    • Antibody neutralization if relevant

  • System-specific controls:

    • For cell-based assays: mock-transfected/transduced cells

    • For binding studies: competition with unlabeled protein

    • For activity assays: enzyme kinetics analysis

The transmembrane nature of the protein presents additional considerations, as protein function may depend on proper membrane orientation and lipid environment. Controls addressing these aspects should be included in experimental design.

How can researchers address inconsistent results when working with Recombinant Mouse C1orf162 homolog?

Inconsistent experimental results with Recombinant Mouse C1orf162 homolog may stem from several sources. Methodological approaches to troubleshoot include:

  • Protein quality assessment:

    • Implement routine quality control before experiments

    • Check for batch-to-batch variation by SDS-PAGE and Western blot

    • Assess protein stability under storage conditions using thermal shift assays

    • Verify proper folding using circular dichroism spectroscopy

  • Experimental conditions optimization:

    • Systematically vary buffer components (pH, salt, detergents)

    • Test different temperatures for functional assays

    • Consider the impact of freeze-thaw cycles on protein activity

    • Evaluate the effect of different plate/tube materials (protein adsorption)

  • Technical standardization:

    • Develop SOPs for protein handling and storage

    • Use single-use aliquots to prevent freeze-thaw degradation

    • Standardize protein concentration determination methods

    • Implement detailed record-keeping of all experimental variables

  • Data analysis approaches:

    • Apply appropriate statistical methods for replicate analysis

    • Consider outlier identification and handling protocols

    • Implement blinding procedures when possible

For transmembrane proteins like C1orf162 homolog, particular attention should be paid to detergent concentration and composition, as these can significantly impact protein behavior and activity.

What techniques are most promising for elucidating the physiological function of C1orf162 homolog?

Determining the physiological function of Mouse C1orf162 homolog will likely require multiple complementary approaches:

  • Gene editing approaches:

    • CRISPR/Cas9 knockout in cell lines and mouse models

    • Conditional knockout systems to avoid developmental effects

    • Knock-in of tagged versions for localization and interactome studies

    • Generation of specific point mutations to test functional hypotheses

  • High-throughput screening:

    • Phenotypic screens following C1orf162 manipulation

    • Interaction screens using BioID or APEX proximity labeling

    • Drug/small molecule modifier screens to identify pathways

  • Multi-omics integration:

    • Transcriptomic analysis following knockout/overexpression

    • Proteomic changes in membrane compartments

    • Lipidomic analysis to identify potential lipid interactions

    • Metabolomic profiling to detect broader cellular changes

  • Structural biology approaches:

    • Cryo-EM analysis of the protein in membrane environments

    • X-ray crystallography of soluble domains

    • NMR studies of dynamics and interactions

The integration of these approaches, combined with evolutionary analysis across species, offers the most comprehensive strategy for functional determination.

How might C1orf162 homolog research contribute to understanding human disease processes?

Although C1orf162 homolog function remains poorly characterized, several avenues connect this research to potential human disease relevance:

  • Comparative genomics approaches:

    • Analysis of human C1orf162 variants in disease databases

    • Identification of disease-associated SNPs in or near the gene

    • Examination of copy number variations affecting expression

  • Disease model investigations:

    • Study C1orf162 expression changes in relevant mouse disease models

    • Determine if knockout or overexpression modifies disease phenotypes

    • Evaluate interactions with known disease-associated proteins

  • Translational connections:

    • Correlation of expression levels with disease biomarkers

    • Investigation of potential diagnostic or prognostic value

    • Exploration as a potential therapeutic target if function suggests relevance

What emerging technologies could advance research on C1orf162 homolog structure and function?

Several cutting-edge technologies offer particular promise for advancing understanding of C1orf162 homolog:

  • Advanced structural approaches:

    • Cryo-electron tomography for visualizing the protein in native membranes

    • Integrative structural biology combining multiple data types

    • AlphaFold2 and related AI approaches for structure prediction

  • Single-molecule techniques:

    • Single-molecule FRET to study conformational changes

    • Optical tweezers to investigate mechanical properties

    • Super-resolution microscopy for precise localization and dynamics

  • Membrane protein-specific tools:

    • Nanodiscs and styrene maleic acid lipid particles (SMALPs) for native-like environments

    • High-throughput reconstitution platforms for functional screening

    • Microfluidic approaches for membrane protein analysis

  • Systems biology integration:

    • Network analysis incorporating C1orf162 homolog

    • Multi-scale modeling from molecular to cellular levels

    • Machine learning approaches to predict function from diverse datasets

These technologies, especially when applied in combination, have the potential to overcome the traditional challenges associated with studying transmembrane proteins like C1orf162 homolog and accelerate functional characterization.

What computational approaches can researchers use to predict C1orf162 homolog functions?

In the absence of extensive experimental data, computational methods offer valuable insights into potential C1orf162 homolog functions:

Computational ApproachApplication to C1orf162Expected Outcomes
Sequence-based analysisIdentification of conserved domains and motifsPrediction of functional elements like binding sites or modification sites
Homology modelingGeneration of 3D structural models based on related proteinsInsights into potential binding pockets and interaction surfaces
Molecular dynamicsSimulation of protein behavior in membrane environmentsUnderstanding of conformational flexibility and lipid interactions
Gene co-expression networksIdentification of genes with similar expression patternsPotential functional associations and pathway memberships
Phylogenetic profilingAnalysis of evolutionary conservation patternsInsights into essential functions and potential interaction partners
Text miningExtraction of implicit connections from scientific literatureIdentification of understudied relationships and hypothesis generation

Researchers should implement multiple computational approaches and look for consensus predictions, as this significantly increases confidence in functional hypotheses that can then be experimentally validated.

How can researchers effectively compare experimental results on C1orf162 homolog across different model systems?

Cross-system comparison requires careful methodological consideration:

  • Standardized assay development:

    • Establish common readouts that can be measured across systems

    • Develop calibration standards applicable to different platforms

    • Implement consistent data normalization approaches

  • Comparative expression analysis:

    • Create expression constructs with identical tags and regulatory elements

    • Quantify expression levels to ensure comparable protein amounts

    • Validate subcellular localization patterns across systems

  • Framework for data integration:

    • Develop quantitative metrics for cross-system comparison

    • Establish minimum dataset requirements for meaningful comparison

    • Implement statistical approaches that account for system-specific variance

  • Collaborative approaches:

    • Establish multi-laboratory studies with standardized protocols

    • Create repositories for raw data sharing

    • Develop common ontologies for phenotypic descriptions

When comparing mouse C1orf162 homolog data with human orthologs or other model organisms, researchers should always consider species-specific differences in cellular context that might affect protein function or interactions.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.