Recombinant Mouse Transmembrane protein C20orf123 homolog

Shipped with Ice Packs
In Stock

Description

Molecular Characterization

Protein Structure:

  • Full-length sequence: 498 amino acids (Mus musculus)

  • Domains: Type II transmembrane topology with extracellular EGF-like domains and intracellular signaling motifs

  • Post-translational modifications: Contains potential N-glycosylation sites and cysteine-mediated dimerization regions

PropertyDetailSource
UniProt IDQ9D611 (Mouse)
Gene ID74614
Molecular Weight~55-60 kDa (calculated)
Tag SystemsHis-tag, Fc-Avi-tag variants

Recombinant Production

Expression Systems:

  • E. coli: Used for full-length protein production with His-tags (≥90% purity)

  • Mammalian cells (HEK293): Preferred for post-translationally modified forms

Biological Roles:

  • Essential for osteoclast multinucleation and bone resorption

  • Interacts with dendritic cell-specific transmembrane protein (DC-STAMP) during cell fusion

Pathway Involvement:

PathwayAssociated Proteins
OsteoclastogenesisDC-STAMP, RANK, NFATc1
Cell Fusion MechanismsCD9, CD47

Biochemical Interactions:

  • Binds integrins via EGF-like domains

  • Forms homodimers through cysteine residues in extracellular regions

Research Applications

Experimental Uses:

  • In vitro osteoclast differentiation assays

  • Protein interaction studies (yeast two-hybrid, co-IP)

  • ELISA-based quantification (detection limit: 0.1-10 ng/mL)

Stability Data:

  • Lyophilized form stable for 24 months at -80°C

  • Working solutions maintain activity for 1 week at 4°C

Activity Validation:

  • Functional testing via osteoclast precursor fusion assays

  • Western blot confirmation using OC-STAMP-101AP antibody

Research Findings

Recent studies demonstrate:

  1. Knockout mice show 80% reduction in osteoclast multinucleation capacity

  2. Dose-dependent inhibition of bone resorption (IC₅₀ = 50 nM) using recombinant protein

  3. Structural analysis reveals pH-dependent conformational changes in extracellular domains

Product Specs

Form
Lyophilized powder
Note: We prioritize shipping the format currently in stock. However, if you have specific format requirements, please specify them in your order, and we will accommodate your needs.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributor for specific delivery timeframes.
Note: All proteins are shipped with standard blue ice packs. If you require dry ice shipping, please inform us in advance as additional fees will apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial prior to opening to collect the contents at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our default final glycerol concentration is 50%. Customers can use this as a reference.
Shelf Life
Shelf life is influenced by various factors, including storage conditions, buffer ingredients, storage temperature, and the protein's inherent stability.
Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Storage Condition
Store at -20°C/-80°C upon receipt. Aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during production. If you have a specific tag type requirement, please inform us, and we will prioritize development of the specified tag.
Synonyms
Ocstamp; Osteoclast stimulatory transmembrane protein; OC-STAMP
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-498
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Ocstamp
Target Protein Sequence
MRTIRAATEHLFGLGWKFWRLGICKAVVPLQAAWKAFSQPVPASCNELLTQLLLCVSLAS LIAGLAHHWLVSLQLYPLGPPALVTSLCGLFVFLSLGLVPPIRCLFVLSVPTLGSKQGRR LLLSYSAANLAVAVVPNVLGNVRAAGQVLSCVTEGSLESLLNTTYQLRQAARELGPASRA GSRSLTFEVEGKGSAFRLHMHTITQEILEDFSGLEFLARAALGTQRVVTGLFLLGLLGES AWYLHRYLTDLRFDNIYATRQLVRQLAQAGATHLLTSPPPWLLQTAQPKLSREELLSCLL RLGLLALLLVATAVTVASDYGAFLLAQAAVAWAQKLPTVPITLTVKYDASYKVLDFILFV LNQPPVESVFASMQRSFQWELRFTPHDCHLPQAQPPRVTAALAAGALQLLAGATLVLQAY AWRLRHTIAASFFPDQEARRLSHLQARLQRRHNQSDHLNKQPGTMATRESRKPGQGTRTL ESQGPQAHDSLGPPYDLE
Uniprot No.

Target Background

Function
This protein is a probable cell surface receptor that plays a crucial role in cellular fusion and cell differentiation. It collaborates with DCSTAMP in regulating cell-cell fusion within both osteoclasts and foreign body giant cells (FBGCs). This protein is involved in osteoclast bone resorption. It promotes osteoclast differentiation and may contribute to the maturation of multinucleated osteoclasts.
Gene References Into Functions
  1. Research suggests that oc-stamp may play a significant role in macrophage polarization and inhibit the M1 pro-inflammatory state. PMID: 28981605
  2. Restoring OC-STAMP in knockout cells through lentiviral transduction rescued fusion and resorption. PMID: 26042409
  3. OC-STAMP is a regulatory molecule for FBGCs; these cells are functionally distinct from OCs, despite similarities in gene expression profile, podosome belt formation, and TRAP expression. PMID: 23444125
  4. Fusogenic mechanisms in macrophage-lineage cells are regulated via OC-STAMP and DC-STAMP. PMID: 22337159
  5. Osteoclast differentiation requires the coordinated expression of OC-STAMP with various molecules necessary for transcription, signaling transduction, and cell fusion. PMID: 20882308
  6. OC-STAMP is a previously unknown, RANKL-induced, multipass transmembrane protein that promotes the formation of multinucleated osteoclasts (Osteoclast stimulatory transmembrane protein). PMID: 18064667

Show More

Hide All

Database Links
Subcellular Location
Membrane; Multi-pass membrane protein.
Tissue Specificity
Expressed in osteoclast (at protein level). Ubiquitous. Highly expressed in multi-nuclear osteoclast cells compared to mono-nuclear macrophages. Expressed in foreign body giant cells (FBGCs).

Q&A

What is the Transmembrane protein C20orf123 homolog and what are its main cellular functions?

The Transmembrane protein C20orf123 homolog, also known as OC-STAMP (Osteoclast Stimulatory Transmembrane Protein), is a cell surface receptor that plays critical roles in cellular fusion processes and cell differentiation. This protein acts as a probable cell surface receptor with significant involvement in modulating cell-cell fusion in both osteoclasts and foreign body giant cells (FBGCs). It is particularly important for osteoclast bone resorption and promotes osteoclast differentiation, contributing to multinucleated osteoclast maturation . The mouse version of this protein is characterized by UniProt accession number Q9D611 and consists of 498 amino acids forming a complete transmembrane protein .

What approaches are recommended for identifying homologs of C20orf123 across different species?

When searching for homologs of C20orf123 across different species, researchers should follow a systematic approach:

  • Database Search Method: Begin by searching the HomoloGene database with the gene name (e.g., "C20orf123" OR "OC-STAMP") and specify the organism if needed .

  • Protein Sequence-Based Approach: If homologs aren't identified through gene name searches, use the protein sequence to conduct a BLAST search:

    • Navigate to the BLAST homepage and select "protein blast"

    • Input the complete amino acid sequence of mouse C20orf123

    • Specify the target organism in the "Organism" field

    • Analyze results based on sequence similarity and coverage

  • Analysis of Conserved Domains: After identifying potential homologs, verify conservation of key functional domains, particularly those involved in transmembrane spanning and cellular fusion mechanisms.

This methodical approach ensures accurate identification of true functional homologs versus proteins with merely structural similarities.

What are the optimal storage and handling conditions for recombinant C20orf123 protein?

Proper storage and handling of recombinant C20orf123/OC-STAMP protein is critical for maintaining its structural integrity and biological activity. Based on established protocols:

Storage ConditionRecommendationPurposeDuration
Short-term storage4°CWorking aliquotsUp to one week
Standard storage-20°CRoutine preservationWeeks to months
Long-term storage-80°CExtended preservationMonths to years
Buffer compositionTris-based buffer with 50% glycerolStability optimization-

Important handling considerations include:

  • Avoid repeated freeze-thaw cycles as they significantly compromise protein integrity

  • Prepare smaller working aliquots to minimize freeze-thaw events

  • When thawing, use controlled temperature gradients rather than rapid warming

  • Maintain sterile conditions throughout handling to prevent microbial contamination

How should researchers design functional assays to study C20orf123/OC-STAMP activity in osteoclast formation?

When designing functional assays to study C20orf123/OC-STAMP activity in osteoclast formation, researchers should consider the following methodological approach:

  • Cell Culture System Selection:

    • Primary bone marrow-derived macrophages (BMDMs) provide a physiologically relevant system

    • RAW264.7 cells offer a more standardized model for preliminary studies

    • Co-culture systems with osteoblasts may better recapitulate in vivo conditions

  • Functional Readouts:

    • Multinucleation assessment (TRAP staining, nuclear counting)

    • Bone resorption capacity (pit formation assays on dentine or synthetic substrates)

    • Expression of osteoclast markers (TRAP, Cathepsin K, RANK)

    • Signaling pathway activation (NF-κB, MAPK pathways)

  • Experimental Controls:

    • Include DCSTAMP expression/activity analysis, as it cooperates with OC-STAMP in cell fusion events

    • Utilize appropriate positive controls (RANKL-induced osteoclastogenesis)

    • Implement negative controls (fusion-inhibiting conditions)

  • Validation Approaches:

    • Gain-of-function studies (overexpression of C20orf123/OC-STAMP)

    • Loss-of-function studies (siRNA, CRISPR-Cas9 knockout)

    • Rescue experiments to confirm specificity

This comprehensive experimental design allows for robust assessment of C20orf123/OC-STAMP function in the context of osteoclast biology.

What immunofluorescence protocols are most effective for studying C20orf123/OC-STAMP localization?

For optimal immunofluorescence visualization of C20orf123/OC-STAMP localization, the following detailed protocol is recommended:

  • Cell Preparation:

    • Culture cells on appropriate coverslips or chamber slides

    • When confluence reaches 70-80%, proceed with fixation

  • Fixation Procedure:

    • Wash cells gently with PBS (1X)

    • Fix with 3.7% paraformaldehyde solution for 15-20 minutes at room temperature

    • For transmembrane proteins like C20orf123, avoid methanol fixation as it can disrupt membrane structures

  • Permeabilization:

    • Treat with 0.2% Triton X-100 solution for 10 minutes

    • For studying specific membrane domains, consider milder permeabilization agents like saponin (0.1%)

  • Blocking and Antibody Incubation:

    • Block with 3-5% BSA or appropriate serum for 1 hour at room temperature

    • Incubate with primary anti-C20orf123 antibody (1:100-1:500 dilution) overnight at 4°C

    • Wash thoroughly with PBS (3x5 minutes)

    • Incubate with appropriate fluorophore-conjugated secondary antibody (1:500-1:2000) for 1 hour at room temperature

    • For co-localization studies, include antibodies against known fusion machinery components (e.g., DCSTAMP)

  • Counterstaining and Mounting:

    • Counterstain nuclei with DAPI (1:1000) for 5 minutes

    • Mount slides using appropriate mounting medium

    • For long-term storage, use anti-fade mounting media

  • Imaging Considerations:

    • For detailed membrane localization, confocal microscopy is preferable

    • Z-stack imaging can help resolve transmembrane localization patterns

    • Super-resolution techniques (STED, STORM) may be necessary for detailed co-localization studies

This protocol can be modified based on specific experimental requirements and cell types being studied.

How does C20orf123/OC-STAMP interact with DCSTAMP to regulate cell fusion in osteoclasts?

The interaction between C20orf123/OC-STAMP and DCSTAMP represents a critical molecular mechanism governing cell fusion during osteoclastogenesis. Current evidence indicates that these two transmembrane proteins cooperate in modulating cell-cell fusion in both osteoclasts and foreign body giant cells (FBGCs) .

The molecular mechanism appears to involve:

  • Cooperative Membrane Localization: Both proteins localize to specific membrane domains where cell fusion occurs. Their co-expression enhances membrane reorganization necessary for fusion events.

  • Signaling Integration: C20orf123/OC-STAMP likely participates in signaling cascades that coordinate with DCSTAMP-mediated pathways. This cooperation may involve:

    • Shared downstream effectors

    • Sequential activation patterns

    • Formation of multiprotein complexes at fusion sites

  • Structural Complementarity: The transmembrane domains of both proteins may interact directly or indirectly to create fusion-competent membrane regions.

  • Differential Regulation: While functionally cooperative, these proteins may be differentially regulated during osteoclast differentiation, providing multiple levels of control over the fusion process.

To study these interactions experimentally, researchers should consider:

  • Co-immunoprecipitation studies to detect physical associations

  • FRET/BRET approaches to analyze proximity in living cells

  • Split-protein complementation assays to monitor interactions in real-time

  • Simultaneous knockdown experiments to assess functional redundancy

This cooperative relationship between C20orf123/OC-STAMP and DCSTAMP highlights the complexity of cellular fusion regulation and offers multiple intervention points for modulating osteoclast formation.

What signaling pathways does C20orf123/OC-STAMP engage to promote osteoclast differentiation?

C20orf123/OC-STAMP engages multiple signaling pathways to promote osteoclast differentiation and function. The integration of these pathways creates a sophisticated regulatory network that controls osteoclast formation and activity:

  • NF-κB Signaling: Evidence suggests that C20orf123/OC-STAMP may influence the NF-κB pathway, a crucial regulator of osteoclastogenesis. Specific mechanisms may include:

    • Modulation of IκB kinase (IKK) complex activity

    • Regulation of NF-κB nuclear translocation

    • Indirect effects through interaction with RANK signaling components

  • MAPK Pathways: C20orf123/OC-STAMP likely influences the MAPK cascades, particularly:

    • p38 MAPK, which regulates osteoclast differentiation

    • ERK1/2, which controls osteoclast survival and activity

    • JNK pathways that contribute to osteoclast formation

  • Calcium Signaling: As a transmembrane protein involved in fusion, C20orf123/OC-STAMP may modulate calcium flux, which is essential for:

    • Membrane fusion events

    • Calcineurin activation and subsequent NFATc1 nuclear translocation

    • Cytoskeletal reorganization during fusion

  • PI3K/Akt Pathway: This survival pathway may be engaged by C20orf123/OC-STAMP to:

    • Promote osteoclast precursor survival

    • Enhance cytoskeletal rearrangements required for fusion

    • Regulate metabolic adaptations during osteoclastogenesis

Experimental approaches to investigate these pathways should include:

  • Phosphorylation state analysis of key signaling components

  • Pathway inhibitor studies to identify critical nodes

  • Transcriptional reporter assays to monitor pathway activation

  • Proteomics approaches to identify interaction partners

Understanding these signaling mechanisms could reveal novel therapeutic targets for conditions characterized by dysregulated osteoclast activity.

How can advanced imaging techniques be applied to study C20orf123/OC-STAMP dynamics during cell fusion?

Advanced imaging techniques offer powerful approaches to visualize and quantify C20orf123/OC-STAMP dynamics during the complex process of cell fusion. These methodologies provide temporal and spatial resolution that traditional biochemical approaches cannot achieve:

  • Live-Cell Imaging Strategies:

    • Fluorescent protein fusion constructs (C20orf123-GFP/RFP) for real-time visualization

    • Photoactivatable/photoconvertible fluorescent proteins to track protein subpopulations

    • FRAP (Fluorescence Recovery After Photobleaching) to assess membrane mobility

    • Single-particle tracking to monitor individual protein complexes

  • Super-Resolution Microscopy Applications:

    • STED (Stimulated Emission Depletion) microscopy to resolve nanoscale protein clusters

    • STORM/PALM techniques to map precise distribution patterns at fusion sites

    • Expansion microscopy to physically enlarge cellular structures for enhanced resolution

    • Lattice light-sheet microscopy for rapid 3D imaging with minimal phototoxicity

  • Multi-Channel Experimental Designs:

    • Co-imaging with membrane markers (DiI, FM dyes) to correlate with membrane dynamics

    • Calcium indicators (Fluo-4, GCaMP) to correlate fusion events with calcium fluxes

    • F-actin probes (LifeAct, SiR-actin) to visualize cytoskeletal reorganization during fusion

  • Quantitative Analysis Approaches:

    • Intensity correlation analysis for co-localization assessment

    • Particle tracking algorithms to determine protein movement patterns

    • Membrane curvature analysis at fusion sites

    • Machine learning-based segmentation and classification of fusion intermediates

Implementation considerations for these techniques include:

  • Appropriate controls to account for phototoxicity and photobleaching

  • Validation of fusion protein functionality through rescue experiments

  • Development of custom analysis pipelines for specific fusion parameters

  • Correlation with electron microscopy for ultrastructural context

These advanced imaging approaches provide researchers with unprecedented ability to dissect the dynamic behavior of C20orf123/OC-STAMP during the complex process of osteoclast fusion.

How should researchers approach contradictory data regarding C20orf123/OC-STAMP function?

When confronted with contradictory data regarding C20orf123/OC-STAMP function, researchers should implement a systematic analytical framework:

  • Methodological Reconciliation:

    • Compare experimental systems (cell lines vs. primary cells vs. in vivo models)

    • Evaluate protein expression levels across studies (physiological vs. overexpression)

    • Assess reagent specificity and validation (antibody validation, genetic tool verification)

    • Analyze timing of observations (early vs. late differentiation stages)

  • Contextual Integration:

    • Consider tissue-specific effects that may explain apparent contradictions

    • Evaluate potential compensatory mechanisms in knockout/knockdown models

    • Assess species differences that might contribute to functional variations

    • Examine microenvironmental factors that could modify protein activity

  • Technical Resolution Strategies:

    • Design decisive experiments addressing specific contradictions

    • Implement multiple complementary techniques to assess the same endpoint

    • Develop quantitative assays with well-defined parameters and controls

    • Consider unbiased approaches (proteomics, transcriptomics) to identify confounding factors

  • Collaborative Approaches:

    • Engage laboratories reporting contradictory findings in collaborative studies

    • Share reagents and protocols to eliminate technical variables

    • Design interlaboratory validation studies with standardized protocols

    • Implement blinded analysis of shared samples to minimize bias

Through this structured approach, researchers can transform apparent contradictions into deeper insights about context-dependent functions and regulatory mechanisms of C20orf123/OC-STAMP.

What statistical methods are most appropriate for analyzing C20orf123/OC-STAMP genetic association data?

When analyzing genetic association data for C20orf123/OC-STAMP in research contexts, the following statistical methods are recommended:

  • Basic Genetic Association Analysis:

    • Chi-square tests for simple genotype-phenotype associations

    • Logistic regression for case-control studies with covariates

    • Linear regression for quantitative trait analysis (e.g., bone density measures)

    • Adjustment for multiple testing (Bonferroni, FDR) to control Type I error

  • Advanced Genetic Statistical Approaches:

    • Haplotype analysis to capture combinatorial effects of variants

    • Gene-environment interaction models for context-dependent effects

    • Meta-analysis techniques for combining data across multiple studies

    • Polygenic risk score development incorporating C20orf123/OC-STAMP variants

  • Functional Genetic Data Analysis:

    • eQTL (expression Quantitative Trait Loci) analysis to link variants to expression levels

    • Splicing QTL analysis to identify variants affecting alternative splicing

    • Pathway enrichment analysis to contextualize genetic findings

    • Network analysis to identify genetic interaction partners

  • Statistical Power Considerations:

    • A priori power calculations based on expected effect sizes

    • Post-hoc power analysis for negative findings

    • Sample size recommendations for detecting variants of different effect sizes

Effect SizeRequired Sample Size (α=0.05, 80% power)
Small (OR=1.2)>5,000 cases and controls
Medium (OR=1.5)1,000-3,000 cases and controls
Large (OR=2.0)300-800 cases and controls

How can researchers integrate C20orf123/OC-STAMP findings with broader osteoclast differentiation datasets?

Integrating C20orf123/OC-STAMP findings with broader osteoclast differentiation datasets requires sophisticated data integration strategies to contextualize specific observations within the complex landscape of osteoclast biology:

  • Multi-Omics Data Integration:

    • Correlation of C20orf123/OC-STAMP expression with transcriptomic profiles during differentiation

    • Integration with proteomics data to identify co-regulated protein networks

    • Phosphoproteomics analysis to connect with signaling pathways

    • Epigenomic data incorporation to understand regulatory mechanisms

  • Network Analysis Approaches:

    • Protein-protein interaction network construction centered on C20orf123/OC-STAMP

    • Pathway enrichment analysis to identify biological processes connected to C20orf123/OC-STAMP

    • Gene regulatory network inference to position C20orf123/OC-STAMP within transcriptional hierarchies

    • Bayesian network modeling to infer causal relationships

  • Temporal Analysis Frameworks:

    • Time-course data alignment to position C20orf123/OC-STAMP activity within differentiation timeline

    • Trajectory analysis methods (pseudotime, RNA velocity) to order cellular states

    • Dynamical system modeling to capture feedback relationships

    • Change-point detection to identify critical transition points in expression

  • Visualization and Knowledge Management:

    • Interactive visualization tools to explore multi-dimensional relationships

    • Knowledge graphs to connect findings with existing literature

    • Machine learning approaches to identify patterns across heterogeneous datasets

    • Public database submission and standardized annotation to facilitate cross-study comparisons

This multifaceted approach allows researchers to position specific C20orf123/OC-STAMP findings within the broader context of osteoclast biology, identifying critical interconnections and potential intervention points for therapeutic development.

What emerging technologies might advance our understanding of C20orf123/OC-STAMP function?

Several cutting-edge technologies show promise for revolutionizing our understanding of C20orf123/OC-STAMP function in cellular fusion and osteoclast biology:

  • CRISPR-Based Technologies:

    • CRISPRi/CRISPRa for temporal control of expression without genetic deletion

    • Base editing for introducing specific point mutations in endogenous loci

    • Prime editing for precise genomic modifications without double-strand breaks

    • CRISPR screens to identify genetic modifiers of C20orf123/OC-STAMP function

  • Advanced Protein Analysis Methods:

    • Proximity labeling (BioID, APEX) to map the local protein environment

    • Hydrogen-deuterium exchange mass spectrometry to analyze conformational dynamics

    • Cryo-EM for structural determination of membrane protein complexes

    • Chemical crosslinking combined with mass spectrometry to capture transient interactions

  • Single-Cell Technologies:

    • Single-cell RNA-seq to identify cell populations with distinctive C20orf123/OC-STAMP activity

    • Spatial transcriptomics to map expression patterns in tissue context

    • Single-cell proteomics to quantify protein levels in rare fusion-competent populations

    • Live-cell single-molecule tracking to monitor individual protein behavior during fusion

  • Organoid and Advanced Culture Systems:

    • Bone organoids to study osteoclast function in tissue-like environments

    • Microfluidic systems to control fusion microenvironments

    • Organ-on-chip models to recreate bone-immune system interactions

    • Bioprinting approaches to create defined spatial arrangements of fusion-competent cells

The integration of these technologies will provide unprecedented insights into the molecular mechanisms, regulation, and physiological significance of C20orf123/OC-STAMP in health and disease states.

What are the most promising therapeutic applications targeting C20orf123/OC-STAMP?

Based on current understanding of C20orf123/OC-STAMP function in osteoclast biology, several promising therapeutic applications are emerging that target this protein for bone-related disorders:

  • Osteoporosis Treatment Strategies:

    • Small molecule inhibitors targeting C20orf123/OC-STAMP extracellular domains

    • Peptide antagonists blocking homotypic interactions during fusion

    • Antibody-based approaches to neutralize C20orf123/OC-STAMP activity

    • Nanobodies with enhanced tissue penetration into bone microenvironments

  • Inflammatory Bone Disease Applications:

    • Dual targeting approaches addressing both C20orf123/OC-STAMP and inflammatory mediators

    • Cell-specific delivery systems targeting osteoclast precursors

    • Temporal modulation strategies allowing normal bone remodeling while preventing pathological resorption

    • Combination therapies with existing anti-inflammatory agents

  • Cancer-Related Bone Disease Interventions:

    • Targeting C20orf123/OC-STAMP to reduce tumor-associated osteolysis

    • Combined approaches addressing both tumor cells and osteoclast activity

    • Metastasis prevention strategies focusing on the bone microenvironment

    • Biomarker development for patient stratification based on C20orf123/OC-STAMP activity

  • Delivery Technology Considerations:

    • Bone-targeting moieties to enhance drug concentration at relevant sites

    • Controlled release formulations for sustained inhibition

    • Stimulus-responsive systems activated by bone resorption markers

    • Gene therapy approaches for long-term modulation of expression

These therapeutic directions offer potential for developing targeted interventions for disorders characterized by excessive osteoclast activity, with reduced systemic effects compared to current broad-spectrum antiresorptive agents.

How might evolutionary analysis of C20orf123/OC-STAMP inform functional studies?

Evolutionary analysis of C20orf123/OC-STAMP provides valuable context for understanding its function, conservation, and adaptation across species. This comparative approach offers multiple insights for functional studies:

  • Cross-Species Conservation Analysis:

    • Identification of highly conserved domains representing critical functional regions

    • Detection of species-specific variations that may correlate with physiological differences

    • Recognition of convergent evolution patterns suggesting functional importance

    • Positioning within protein families to predict shared mechanisms

  • Methodological Approaches for Evolutionary Studies:

    • Phylogenetic analysis using maximum likelihood or Bayesian methods

    • Selection pressure analysis (dN/dS ratios) to identify adaptive evolution

    • Ancestral sequence reconstruction to infer evolutionary trajectories

    • Synteny analysis to examine genomic context conservation

  • Functional Implications of Evolutionary Patterns:

    • Using conserved regions to guide mutagenesis experiments

    • Developing chimeric proteins exchanging domains between species

    • Understanding species-specific differences in osteoclast biology

    • Predicting interaction interfaces based on co-evolution patterns

  • Database Resources and Tools:

    • HomoloGene database for pre-computed homolog identification

    • BLAST searches with species constraints for finding distant homologs

    • Specialized tools for protein domain conservation mapping

    • Integrative databases connecting sequence, structure, and function

By applying these evolutionary approaches, researchers can generate hypotheses about C20orf123/OC-STAMP function, prioritize regions for experimental investigation, and better understand the fundamental mechanisms of osteoclast fusion that have been conserved throughout evolution.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.