Recombinant Mouse Transmembrane protein C5orf28 homolog (Gm7120)

Shipped with Ice Packs
In Stock

Product Specs

Form
Supplied as a lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference in order notes for customized fulfillment.
Lead Time
Delivery times vary depending on the purchase method and location. Please contact your local distributor for precise delivery estimates.
Note: Standard shipping includes blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile deionized water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our standard glycerol concentration is 50% and serves as a guideline.
Shelf Life
Shelf life depends on several factors including storage conditions, buffer composition, temperature, and protein stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The specific tag type is determined during production. If you require a specific tag, please inform us, and we will prioritize its inclusion in the manufacturing process.
Synonyms
Tmem267; Gm7120; Transmembrane protein 267
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-215
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Tmem267
Target Protein Sequence
MASKVEKTHALPPCCSTESLISSIGLGIFCLVADRLLRFPIIQHNDWLRAISDNIVHGVI GMWSWAVVTGIRKKSDFGEVLLAGFLASVIDVDHFFQARSLSLQAALTLPRRPFLHCSTV IPIAVLSVKLAVHLFKLRDSWRFLPWMILVSWTSHHIRDGIRHGLWICPFGKTPPLPSSF YVISTLSLPHLCSFLMYLTGTRQTVSSKYGMRIDV
Uniprot No.

Target Background

Database Links

KEGG: mmu:633640

UniGene: Mm.46679

Subcellular Location
Membrane; Multi-pass membrane protein.

Q&A

What is Recombinant Mouse Transmembrane protein C5orf28 homolog (Gm7120)?

Recombinant Mouse Transmembrane protein C5orf28 homolog (Gm7120) is a full-length protein consisting of 215 amino acids that functions as a transmembrane protein in mice. The protein is encoded by the Gm7120 gene and is identified in the UniProt database with the accession number Q8VDR5. Its structural characteristics include transmembrane domains that anchor it within cellular membranes, with specific topological orientation allowing for interactions with both intracellular and extracellular environments. The recombinant versions of this protein are typically expressed with tags (such as His-tags) to facilitate purification and experimental manipulation in research settings .

How should Gm7120 be stored and handled in laboratory settings?

For optimal stability and activity maintenance, recombinant Gm7120 protein should be stored at -20°C for standard laboratory timeframes, while extended storage should be maintained at -80°C. The protein is typically supplied in a Tris-based buffer containing 50% glycerol that has been optimized for protein stability. To prevent protein degradation, repeated freeze-thaw cycles should be avoided; instead, working aliquots can be maintained at 4°C for up to one week. When handling the protein, standard laboratory practices for working with recombinant proteins should be followed, including the use of sterile techniques and appropriate personal protective equipment to prevent contamination and ensure reproducible experimental results .

How should experiments investigating Gm7120 function be designed?

When designing experiments to investigate Gm7120 function, researchers should follow key experimental design principles to ensure robust and reproducible results. First, clearly define your experimental variables - identify Gm7120 or its domains as your independent variable (what you're manipulating) and specify measurable dependent variables (such as binding interactions, cellular localization, or downstream signaling effects). Control variables must be rigorously maintained across experimental conditions, including cell types, incubation times, buffer compositions, and temperature. Additionally, appropriate negative controls (such as non-related transmembrane proteins) and positive controls should be included in the experimental design .

For transmembrane proteins like Gm7120, consider using both in vitro systems (such as liposome incorporation) and cellular models to validate findings across different experimental contexts. Data should be collected with appropriate technical and biological replicates (minimum n=3) and analyzed using statistical methods appropriate for the experimental design. Confounding variables, particularly post-translational modifications that might affect protein function, should be identified and controlled for whenever possible .

What data collection and analysis methods are appropriate for Gm7120 studies?

Data collection for Gm7120 studies should follow rigorous protocols with clearly defined variables and measurements. When collecting experimental data, researchers should construct comprehensive data tables that include titles describing the specific data being collected, appropriate column and row labels with units and measurement uncertainty, and consistent precision across all numerical values. Raw data should be recorded alongside processed data (such as averages and standard deviations) to enable thorough analysis and reproducibility verification .

For data analysis, stepwise regression approaches can be particularly valuable when studying Gm7120 in the context of regulatory networks. This method can identify potential regulatory relationships between Gm7120 and other genes or proteins. When analyzing expression data, correction for batch effects, population structure, gender, and age should be implemented to isolate the true biological signal. Statistical significance should be determined using appropriate tests (such as the hypergeometric test for overlap analysis) with correction for multiple testing (e.g., using a 5% false discovery rate) .

How can researchers validate the identity and purity of recombinant Gm7120?

Validation of recombinant Gm7120's identity and purity requires a multi-faceted analytical approach. Begin with SDS-PAGE analysis to confirm the expected molecular weight of approximately 24-27 kDa (depending on post-translational modifications), complemented by Western blot analysis using antibodies specific to either Gm7120 or the fusion tag (e.g., anti-His antibodies for His-tagged constructs). Mass spectrometry analysis should be performed to verify the amino acid sequence and any post-translational modifications, with particular attention to potential glycosylation sites that may affect protein function .

Purity assessment should include size-exclusion chromatography to detect aggregation or degradation products, and circular dichroism spectroscopy to confirm proper folding of the protein's secondary structure elements. For transmembrane proteins like Gm7120, additional validation may include liposome incorporation assays to verify membrane integration capability. Functional validation can be performed through binding assays with known or predicted interaction partners. Each validation method should include appropriate controls and standards for comparison, with comprehensive documentation of all validation parameters and results .

How can Gm7120 be incorporated into regulatory network analyses?

Incorporating Gm7120 into regulatory network analyses requires sophisticated computational approaches combined with experimental validation. Begin by identifying genes expressed in the cell types of interest that have non-negligible transcriptional variation scores, as demonstrated in studies of immune cells where over 3,600 genes were analyzed for network construction. For Gm7120 specifically, determine whether it functions as a transcription factor or a target gene based on its cellular localization and functional domains .

To construct the regulatory network, apply stepwise regression methods where potential regulators (transcription factors) are systematically tested for each target gene, including Gm7120. Significance of regulatory relationships should be determined using a 5% false discovery rate to correct for multiple testing. The resulting network can be visualized and analyzed to identify direct regulators or targets of Gm7120, as well as its position within larger regulatory cascades. For cross-species comparisons, such as between mouse and human homologs, construct separate networks for each species and then calculate the replication rate of links using statistics like p1 to quantify the proportion of true positives among co-expression values .

What approaches can address data inconsistencies in Gm7120 research?

Addressing data inconsistencies in Gm7120 research requires systematic identification and resolution of contradictions through anti-pattern analysis. When contradictory results appear in the literature or datasets regarding Gm7120's function, expression patterns, or interactions, researchers should first categorize these inconsistencies into specific anti-patterns – recognizable patterns of contradictions that stem from similar modeling or experimental mistakes. This approach allows for systematic detection and resolution of logical errors across different knowledge sources .

How does Gm7120 expression vary across inbred mouse strains?

Analysis of Gm7120 expression variation across inbred mouse strains requires sophisticated genomic and transcriptomic approaches that account for genetic background effects. When investigating such variation, researchers should implement PC-correction methods to account for population structure, using at least two principal components derived from genotype data. This correction is essential for distinguishing true biological variation from artifacts introduced by genetic background differences among mouse strains .

Expression analysis should focus on identifying non-negligible transcriptional variation (TV) scores for Gm7120, which indicate biologically meaningful expression differences. For comparative studies between mouse strains, batch effects must be carefully controlled, and all mice should ideally have identical gender and age to minimize confounding factors. When analyzing co-expression patterns, use Pearson correlation coefficients to identify the top targets co-regulated with Gm7120, followed by hypergeometric testing to assess the significance of these associations. The resulting strain-specific expression profiles can provide valuable insights into how genetic background influences Gm7120 function, potentially revealing strain-specific regulatory mechanisms that affect transmembrane protein expression and activity .

How can researchers compare mouse Gm7120 with its human homolog C5orf28?

Comparing mouse Gm7120 with its human homolog C5orf28 requires a multi-layered approach combining sequence analysis, expression profiling, and functional characterization. Begin with sequence alignment to quantify conservation at both the nucleotide and protein levels, identifying conserved domains and critical functional residues. For regulatory network comparisons, construct separate networks for each species using stepwise regression on expression data, correcting mouse data for genotype principal components and human data for batch effects, population structure, gender, and age .

To assess conservation of regulatory relationships, identify the top targets (e.g., top 10-50) of Gm7120/C5orf28 in each species based on co-expression values, then test for significant overlap using the hypergeometric test. Additionally, apply the Wilcoxon rank sum test to compare the distribution of co-expression values for top targets against the background distribution. This statistical framework can determine whether the regulatory relationships are conserved despite species differences. For transmembrane proteins like Gm7120, special attention should be paid to conservation of membrane topology, post-translational modification sites, and interaction interfaces that may affect cellular localization and function across species .

What experimental systems are optimal for studying Gm7120 function?

The optimal experimental systems for studying Gm7120 function depend on the specific research questions being addressed. For basic biochemical characterization, in vitro systems using purified recombinant protein incorporated into liposomes or nanodiscs can provide insights into membrane topology and structural properties. Cell-based systems should include both mouse cell lines (to study the protein in its native context) and heterologous expression systems (such as HEK293 cells) for comparative analyses .

For regulatory network studies, primary immunocytes from different inbred mouse strains offer a powerful system to examine how genetic background influences Gm7120 expression and function. When designing such experiments, researchers should correct for batch effects and genetic background using principal component analysis of genotype data. For functional studies, CRISPR-Cas9 knockout or knockdown approaches can reveal phenotypic consequences of Gm7120 loss, while tagged overexpression systems facilitate localization and interaction studies. Regardless of the chosen system, experiments should include appropriate controls, multiple biological replicates, and validation across different experimental paradigms to ensure robust and reproducible results .

How should researchers present Gm7120 experimental data in publications?

When presenting Gm7120 experimental data in publications, researchers should follow strict guidelines for data table construction and visualization to ensure clarity and reproducibility. Data tables must include descriptive titles specific to the data presented (not repeating research questions), with clearly labeled columns including units and measurement uncertainty for raw data. All numerical values should maintain consistent precision (significant digits) throughout the table. For Gm7120 expression or functional studies, include both raw data from individual experimental replicates and processed data (means and standard deviations) to enable comprehensive analysis by readers .

For regulatory network analyses involving Gm7120, visualize the network using directed graphs that clearly indicate the direction of regulation, with statistical significance of each interaction noted. When presenting comparative data between mouse Gm7120 and human C5orf28, construct parallel tables or graphs that highlight conserved and divergent features. All figures should include comprehensive legends explaining experimental conditions, sample sizes, and statistical analyses performed. For sequence data, use standard formatting conventions for amino acid sequences, with critical functional domains or residues highlighted. Always include detailed methodological descriptions that would enable other researchers to replicate the experiments, with particular attention to protein expression, purification, and validation procedures .

What statistical approaches are recommended for analyzing Gm7120 functional data?

Statistical analysis of Gm7120 functional data requires rigorous approaches tailored to the specific experimental design and data characteristics. For experiments comparing Gm7120 function across different conditions, begin with appropriate descriptive statistics (means, standard deviations, confidence intervals) followed by inferential statistical tests. For parametric data, ANOVA with post-hoc tests (such as Tukey's HSD) can identify significant differences between multiple experimental conditions, while non-parametric alternatives (Kruskal-Wallis, Mann-Whitney U) should be applied to data that violate normality assumptions .

For regulatory network analyses, implement stepwise regression to identify significant regulators of Gm7120 expression, using a 5% false discovery rate to correct for multiple testing. When analyzing coexpression patterns, calculate Pearson correlation coefficients and assess significance using p-value distributions. For cross-species comparative analyses, use the hypergeometric test to evaluate the significance of overlapping targets between mouse Gm7120 and human C5orf28, and the Wilcoxon rank sum test to compare distribution patterns of coexpression values. All statistical approaches should be clearly documented with appropriate justification for the chosen methods, and results should include both effect sizes and measures of statistical significance to enable comprehensive interpretation .

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.