Recombinant Mouse Transmembrane protein C9orf123 homolog
Shipped with Ice Packs 
In Stock 
Description
Functional Insights
Role in Mitochondrial Complex I Assembly
-
Essential for assembling the distal membrane arm of mitochondrial NADH:ubiquinone oxidoreductase (Complex I) .
-
Depletion via siRNA disrupts Complex I integrity, impairing cellular energy metabolism .
Evolutionary Conservation
-
Shares 49% sequence identity with human TMEM261 and 41% with rat orthologs .
-
Transmembrane domains are evolutionarily conserved across species .
Research Applications
Antibody-Based Studies
-
Polyclonal antibodies (e.g., PA5-53197) detect strong cytoplasmic staining in human gall bladder tissues .
-
Immunogen sequence:
MGSRLSQPFE SYITAPPGTA AAPAKPAPPA TPGAPTSPAE HRLLKTCWSC.
siRNA and Knockdown Tools
-
siRNA oligos (e.g., Cat. No. 14774171) achieve >70% knockdown efficiency in murine models .
-
Validated targets include mitochondrial dysfunction and cancer pathways .
Table 2: C9orf123 in Cancer Research
| Study Focus | Key Findings | Source |
|---|---|---|
| Genomic amplification | Co-amplified with UHRF2 and GASC1 in cancers (Kendall’s τ = 0.83) | |
| Oncogenic potential | Linked to tumor proliferation in breast, colon, and lung cancers |
Unresolved Questions and Future Directions
Product Specs
Form
Lyophilized powder
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order. We will fulfill your request whenever possible.
Note: We will prioritize shipping the format currently in stock. However, if you have specific format requirements, please indicate them in your order. We will fulfill your request whenever possible.
Lead Time
Delivery time may vary depending on the purchase method and location. Please consult your local distributors for specific delivery timelines.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please notify us in advance, as additional fees may apply.
Note: All of our proteins are shipped with standard blue ice packs. If you require dry ice shipping, please notify us in advance, as additional fees may apply.
Notes
Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week.
Reconstitution
We recommend briefly centrifuging the vial before opening to ensure the contents settle at the bottom. Reconstitute the protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. For long-term storage, we recommend adding 5-50% glycerol (final concentration) and aliquoting at -20°C/-80°C. Our default final glycerol concentration is 50%, which can serve as a reference point.
Shelf Life
The shelf life is influenced by multiple factors, including storage conditions, buffer components, storage temperature, and the inherent stability of the protein itself.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Generally, liquid forms have a shelf life of 6 months at -20°C/-80°C. Lyophilized forms have a shelf life of 12 months at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquoting is recommended for multiple uses. Avoid repeated freeze-thaw cycles.
Tag Info
Tag type will be determined during the manufacturing process.
The tag type will be determined during the production process. If you have a specific tag type requirement, please inform us, and we will prioritize developing the specified tag.
Synonyms
Dmac1; Tmem261; Distal membrane-arm assembly complex protein 1; Transmembrane protein 261
Buffer Before Lyophilization
Tris/PBS-based buffer, 6%
Trehalose.
Datasheet
Please contact us to get it.
Expression Region
1-111
Protein Length
full length protein
Species
Mus musculus (Mouse)
Target Names
Dmac1
Target Protein Sequence
MGSSFSGSTEFSAPAPPTVSTAVPANPPAKSAVPASPARDPELKTCWSCRVLSGSTLFGA
GTYVYLVARRPLKQGIPPGPGTVLQMVIGISIACWGVVVLVDPKGKSHPVI
Uniprot No.
Target Background
Function
Essential for the assembly of the mitochondrial NADH:ubiquinone oxidoreductase complex (complex I). Plays a role in the assembly of the distal region of complex I.
Database Links
Subcellular Location
Mitochondrion inner membrane; Multi-pass membrane protein.
Quick Inquiry
Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
