Tripartite motif-containing protein 59 (Trim59), also known as RING finger protein 1 (Mrf1), is a protein-coding gene in Mus musculus (mouse) . TRIM59 is a member of the TRIM family, which is known to function in various diseases, including cancers and immune-related diseases . It contains a RING finger domain, a B-box domain, and a coiled-coil region .
Trim59 is expressed in various tissues in mice. Immunohistochemistry showed abundant expression in the spleen, stomach, and ovary, intermediate expression in the brain, lung, kidney, muscle, and intestine, and no expression in the thymus, liver, heart, and uterus .
TRIM59 is involved in multiple cellular processes, including the regulation of tumorigenesis, tumor progression, and immune responses .
Role in Macrophages: TRIM59 is specifically expressed on the membrane of BCG-activated macrophages (BAM). Blocking TRIM59 on BAM significantly reduces BAM cytotoxicity against MCA207 cells, indicating that TRIM59 is essential for maintaining BAM activity. Overexpression of Trim59 enhances pinocytosis and phagocytosis activity, suggesting it mediates cell-molecule interactions .
Role in Cancers: TRIM59 is identified as an early signal transducer in oncogene pathways in murine prostate cancer models. Upregulation and hyperphosphorylation of the TRIM59 protein occur in the cytoplasm during early tumorigenesis. Knockdown of TRIM59 in human prostate cancer cells results in S-phase arrest and cell growth retardation .
Diagnostic and Prognostic potential: TRIM59 can be used as a diagnostic marker in different types of human cancers. High expression of TRIM59 shows high diagnostic efficacy in various tumor types. High expression of TRIM59 also shows significant poor prognosis in kidney renal papillary cell carcinoma (KIRP), lower grade glioma (LGG), lung adenocarcinoma (LUAD), and lung cancer .
Role in Ischemic Stroke: TRIM59 deficiency worsens experimental ischemic stroke and alters the cerebral proteomic profile. TRIM59 may affect changes in clusterin expression by influencing the secretion of complement C3 in macrophages .
Recombinant mouse Trim59 protein is produced using genetic engineering techniques, where the Trim59 gene is expressed in a host organism like E. coli, and the resulting protein is isolated and purified . Creative BioMart offers a recombinant full-length mouse Trim59 protein with an N-terminal His tag, expressed in E. coli .
Specifications of Recombinant Mouse Trim59 Protein:
| Category | Description |
|---|---|
| Species | Mus musculus |
| Source | E. coli |
| Tag | His |
| Protein Length | Full Length (1-403 amino acids) |
| Form | Lyophilized powder |
| Purity | Greater than 90% as determined by SDS-PAGE |
| Storage | Store at -20°C/-80°C upon receipt, aliquoting is necessary for multiple uses. Avoid repeated freeze-thaw cycles. |
| Storage Buffer | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
| Reconstitution | Briefly centrifuge the vial prior to opening to bring the contents to the bottom. Reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL. Adding 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃ is recommended. Default final concentration of glycerol is 50%. |
| Gene Name | Trim59 |
| Synonyms | Trim59; Mrf1; Tripartite motif-containing protein 59; RING finger protein 1 |
| UniProt ID | Q922Y2 |
| AA Sequence | MHNFEEELTCPICYSIFEDPRVLPCSHTFCRNCLENVLQASGNFYIWRPLRIPLKCPNCR SIIEIASTGIESLPVNFALRAIIEKYQQEDHPDVVTCPEHYRQPLNVYCLLDKKLVCGHC LTIGQHHGHPIDDLQSAYLKEKDTPQKLLKQLTDTHWTDITRLIEKLEEQKCHSEKIVQG DKEVVLQYFKELIDTLEQKKKYFLAALCDVGKMINQEYTPQIQGMKEIREQQLELMTITT SLQDESPLKFLEKIDEVRQRVQMLKQRPLPEVQPVEIYPRVSNVLKEEWSRIEIGRIKKA VIPEMRVSSKRTPCSWSDNDEKEMELFKILNIAIVSLISVILMLILLFNHHIITFLNEIT SICFSEVFLSVYQSLSKNLYDLNNTVCYTLYLLKEFMWKIVSR |
TRIM59 expression was investigated for its prognostic value in patients with non-small cell lung cancer (NSCLC). The results from one study are shown below:
| Parameter | B | SE | Wald | P-value | OR | Lower | Upper |
|---|---|---|---|---|---|---|---|
| Age | 0.021 | 0.011 | 3.928 | 0.047 | 1.022 | 1.000 | 1.043 |
| pT | 0.682 | 0.430 | 2.520 | 0.122 | 1.978 | 0.852 | 4.591 |
| pN | 0.802 | 0.386 | 4.304 | 0.038 | 2.229 | 1.045 | 4.754 |
| Stage | −0.040 | 0.395 | 0.010 | 0.919 | 0.961 | 0.443 | 2.083 |
| TRIM59 | 0.528 | 0.223 | 5.597 | 0.018 | 1.696 | 1.095 | 2.626 |
Mouse Trim59 (also known as Mrf1, TSBF1, or RNF104) is encoded by the Mrf1 gene, which contains two exons (63 and 2665 bp) and one intron exceeding 13 kb. The open reading frame is located exclusively in exon 2, encoding a 403-amino acid protein of the RING-B box-coiled coil (tripartite motif) type .
Western blotting analysis has identified Trim59 as an approximately 44 kD protein in brain extracts of mouse, rat, and human . Expression studies show moderate expression in spleen, brain, and heart as a single 3.0 kb transcript, while testis shows high expression with two distinct transcripts (3.0 and 1.5 kb) . The Mrf1 gene maps to mouse chromosome 3, between markers D3Mit70 and D3Mit277 .
When bone marrow-derived macrophages (BMDMs) are stimulated with lipopolysaccharide (LPS), Trim59 expression is significantly suppressed. Quantitative RT-PCR and western blot analyses reveal that both mRNA and protein levels of Trim59 decrease in a time-dependent manner following LPS stimulation (0.2 μg/ml) . This downregulation is also dose-dependent, with higher concentrations of LPS leading to more pronounced suppression of Trim59 expression .
This expression pattern suggests that Trim59 may serve as a regulatory checkpoint during inflammatory activation of macrophages, where its downregulation might facilitate the initial inflammatory response while its restoration could contribute to resolution phases.
Several genetically engineered mouse models have been developed for Trim59 research:
Conditional knockout mice: Trim59-flox/flox mice with floxed alleles can be crossed with tissue-specific Cre lines to generate conditional knockouts .
Myeloid-specific knockout: Trim59-flox/flox mice crossed with Lyz2-Cre mice (Trim59-cKO) enable the study of Trim59 deletion specifically in myeloid lineage cells, particularly macrophages .
Intestinal epithelial cell-specific knockout: Trim59-flox/flox mice crossed with Villin-Cre mice allow for the investigation of Trim59 function in intestinal epithelial cells .
These models are housed under specific-pathogen-free (SPF) conditions with temperature control, 12h/12h light/dark cycles, and unrestricted access to food and water .
Trim59 deficiency in macrophages promotes a pro-inflammatory M1 phenotype while inhibiting M2 polarization. In Trim59-knockout bone marrow-derived macrophages (BMDMs), there is increased expression of pro-inflammatory cytokines through enhanced activation of the NF-κB signaling pathway .
Specifically, when Trim59 is deleted in macrophages:
Pro-inflammatory cytokine secretion (TNF-α, IL-6, IL-1β) is significantly upregulated
Fcγ receptor expression is reduced, impairing phagocytosis function
NF-κB pathway activation is enhanced, driving inflammatory gene transcription
This phenotype has important implications in disease models. In sepsis models, Trim59-cKO mice show increased mortality (30% survival rate compared to 50% in control mice), elevated liver and lung damage, and higher bacterial burden following cecal ligation and puncture (CLP) surgery .
Trim59 exhibits context-dependent functions that appear contradictory between different disease models:
Trim59 in macrophages protects mice from sepsis-induced mortality
Promotes bacterial clearance through enhanced phagocytosis
Trim59 deficiency in macrophages inhibits colorectal tumorigenesis
Macrophage-specific Trim59 knockout mice (Trim59f/f Lyz2-cre) show greater tolerance to DSS treatment in colitis-associated cancer models
Trim59 is upregulated in various human cancers, including colorectal cancer, suggesting a tumor-promoting function
This apparent contradiction may be reconciled by considering that inflammation has different consequences in infectious versus malignant contexts. In sepsis, controlled inflammation with effective phagocytosis (promoted by Trim59) is beneficial. In contrast, cancer often exploits anti-inflammatory, tumor-promoting macrophages (M2 phenotype) to evade immune surveillance, so Trim59 deficiency may shift the balance toward anti-tumor inflammation.
Trim59 serves as a negative regulator of NF-κB signaling in macrophages. When Trim59 is knocked out in bone marrow-derived macrophages (BMDMs), there is enhanced activation of the NF-κB pathway following inflammatory stimulation, resulting in increased production of pro-inflammatory cytokines .
The molecular mechanisms may involve:
Protein-protein interactions: As a tripartite motif protein containing a RING domain, Trim59 likely functions as an E3 ubiquitin ligase that targets specific components of the NF-κB pathway for ubiquitination .
Ubiquitination-dependent regulation: Trim59 may promote the degradation of positive regulators or stabilize negative regulators of the NF-κB pathway through its ubiquitin ligase activity .
Cross-regulation with pattern recognition receptors: Trim59 expression is suppressed following LPS stimulation, suggesting feedback regulation involving TLR4 and possibly other pattern recognition receptors .
Further biochemical studies are needed to identify the direct targets of Trim59 within the NF-κB pathway and characterize the specific ubiquitination patterns (K48 versus K63-linked) involved.
For optimal culture of BMDMs to study Trim59 function, follow these methodological guidelines:
Isolation protocol: Extract bone marrow cells from femurs of 6-8 week old mice (wild-type or Trim59-flox/flox).
Culture medium: Use DMEM supplemented with:
10% fetal bovine serum (FBS)
30% conditioned medium from L929 fibroblast cell line (source of M-CSF)
Culture duration: Maintain cells in culture for 7 days to allow complete differentiation into macrophages.
Verification of purity: Assess macrophage purity using F4/80 staining. Studies report achieving approximately 93.5% purity in BMDMs from C57BL/6N mice .
Pre-experiment rest period: Culture BMDMs overnight prior to experimentation to ensure they are in a resting state .
For Trim59 expression studies, stimulate BMDMs with LPS (0.2 μg/ml) for various durations (0-24h) to observe time-dependent changes, or use different LPS concentrations to establish dose-dependent responses .
Based on successful studies, the following approaches are recommended for generating and validating Trim59 conditional knockout models:
Create Trim59-flox/flox mice with LoxP sites flanking critical exons (commercial sources like Cyagen Biosciences and Gempharmatech have developed these models) .
Cross these mice with tissue-specific Cre recombinase-expressing mice:
Genotyping: PCR-based confirmation of the floxed alleles and Cre transgene.
Tissue-specific deletion verification:
RNA level: qRT-PCR of isolated target cells (e.g., BMDMs from Trim59f/f Lyz2-cre mice)
Protein level: Western blot analysis of target tissue lysates
Functional validation:
For accurate assessment of knockout efficiency, compare Trim59 expression between Cre-positive mice and Cre-negative littermate controls (Trim59f/f without Cre) rather than wild-type mice.
Based on research findings, the following disease models are particularly suitable for investigating Trim59 functions:
Cecal Ligation and Puncture (CLP): This surgical model creates polymicrobial sepsis and has successfully demonstrated the protective role of Trim59 in macrophages .
Evaluation parameters: Survival rate, serum ALT/AST levels, histopathological analysis of liver and lung tissues, and bacterial burden assessment .
AOM/DSS-induced colitis-associated cancer: Using azoxymethane (AOM) followed by cycles of dextran sodium sulfate (DSS) treatment .
Subcutaneous tumor transplantation: Using MC38 colorectal cancer cells for a more controlled tumor growth model .
Evaluation parameters: Body weight changes, tumor number, tumor load, tumor size distribution, and colon length .
Oxidized LDL-induced endothelial inflammation: While primarily studied in cell cultures, this model reveals Trim59's role in vascular inflammation and could be extended to in vivo models .
When designing these experiments, researchers should consider using both global and tissue-specific Trim59 knockout models to delineate cell-specific contributions to disease pathogenesis.
When encountering conflicting data on Trim59 function, researchers should systematically evaluate:
Trim59 functions differently in distinct cell types and disease contexts. For example, it protects against sepsis but may promote tumor growth in cancer models .
Consider cell type-specific signaling environments when comparing macrophage studies with epithelial or other cell studies.
Different knockout strategies (global vs. conditional) may yield different phenotypes due to developmental compensation or cell-cell interactions.
In vitro versus in vivo studies may show discrepancies due to the complex microenvironment in whole organisms.
Genetic background of mice can influence phenotypes. Compare studies using identical mouse strains (e.g., C57BL/6N versus other backgrounds).
Variations in cell isolation, culture conditions, stimulation protocols, and analytical techniques can contribute to divergent results.
Standardize experimental protocols when comparing results across studies.
Many immune regulators exhibit dual functions depending on context (e.g., pro-inflammatory in acute infection but anti-inflammatory in chronic settings).
Consider that Trim59 may have multiple targets with opposing effects depending on cellular status.
To reconcile conflicting findings, design experiments that directly compare Trim59 function across different contexts within the same experimental system.
Researchers working with recombinant mouse Trim59 protein may face several technical challenges:
As a tripartite motif protein with multiple domains, Trim59 may have solubility challenges during recombinant expression.
Solution: Optimize expression conditions (temperature, induction time), try different solubility tags (His, GST, MBP), and consider expressing individual domains separately.
Ensuring that recombinant Trim59 retains its E3 ubiquitin ligase activity and proper folding.
Solution: Validate activity through in vitro ubiquitination assays and circular dichroism to confirm structural integrity.
Determining the specificity of Trim59 for ubiquitination targets.
Solution: Use co-immunoprecipitation followed by mass spectrometry, yeast two-hybrid screening, or proximity labeling approaches.
Commercial antibodies may show cross-reactivity with other TRIM family members.
Solution: Validate antibodies using Trim59 knockout cells/tissues as negative controls and perform epitope mapping.
Establishing reliable assays to measure the specific ubiquitination activity of Trim59.
Solution: Develop in vitro ubiquitination assays with purified components and validate with mutant versions lacking the RING domain.
When working with custom-made recombinant Trim59, researchers should request detailed expression and purification protocols from providers and perform functional validation before proceeding with complex experiments.
To effectively investigate the relationship between Trim59 and NF-κB signaling:
Examine multiple levels of the NF-κB pathway (phosphorylation of IKK complex, IκBα degradation, p65 nuclear translocation, and DNA binding)
Use both biochemical approaches (Western blotting) and imaging techniques (immunofluorescence for p65 localization)
Analyze NF-κB activation at multiple time points after stimulation in Trim59-sufficient versus deficient cells
This approach reveals whether Trim59 affects early activation, sustained signaling, or resolution phases
Perform co-immunoprecipitation studies to identify which NF-κB pathway components interact with Trim59
Utilize ubiquitination assays to determine if Trim59 directly ubiquitinates NF-κB regulators
Consider proteomic approaches to identify ubiquitinated targets in the presence/absence of Trim59
Reconstitute Trim59-deficient cells with wild-type Trim59 or domain mutants (especially RING domain mutants)
This approach helps establish which domains are essential for NF-κB regulation
Beyond pathway activation, measure expression of NF-κB target genes by qRT-PCR or RNA-seq
Compare pro-inflammatory cytokines (TNF-α, IL-6, IL-1β) and genes involved in negative feedback regulation
Investigate potential interactions between Trim59 and other inflammatory signaling pathways (MAPK, JAK-STAT) that might indirectly affect NF-κB
These approaches will provide a comprehensive understanding of how Trim59 regulates NF-κB signaling in inflammatory contexts.
While Trim59's role in macrophages has been investigated, several critical questions remain about its function in other immune cell populations:
Dendritic cells: Does Trim59 regulate antigen presentation capacity or cytokine production in different DC subsets?
T cells: What role might Trim59 play in T cell activation, differentiation, and cytokine production? How does it affect different T helper subsets?
B cells: Is Trim59 involved in B cell receptor signaling, antibody production, or plasma cell differentiation?
Natural killer cells: Does Trim59 regulate NK cell cytotoxicity or cytokine production in response to different stimuli?
Neutrophils: What role does Trim59 play in neutrophil recruitment, NETosis, or antimicrobial functions?
These questions could be addressed through generating additional conditional knockout models using cell type-specific Cre lines (CD11c-Cre for DCs, CD4-Cre for T cells, CD19-Cre for B cells, etc.) and subjecting them to relevant immune challenge models.
Based on current research findings, Trim59-targeted therapeutics could have distinct applications:
Enhancing Trim59 expression or function could be beneficial by:
Potential approaches include Trim59 recombinant protein delivery, gene therapy, or small molecules that enhance Trim59 stability or function.
Inhibiting Trim59 could have anti-tumor effects by:
Potential approaches include Trim59 inhibitors, siRNA/shRNA delivery, or targeted degradation strategies.
The dual role of Trim59 in different disease contexts necessitates careful therapeutic design with tissue or cell-type specific delivery systems to avoid unintended effects.
Single-cell technologies offer powerful approaches to unravel Trim59's complex functions in diverse immune contexts:
Can reveal cell-specific expression patterns of Trim59 across immune subpopulations
Enables identification of rare cell populations where Trim59 plays critical roles
Allows trajectory analysis to understand how Trim59 expression changes during cell differentiation or activation
Can identify changes in chromatin accessibility in Trim59-deficient cells
Helps understand how Trim59 might influence epigenetic regulation in different immune cell types
Combines surface protein and transcriptome analysis to correlate Trim59 expression with cell surface markers
Particularly valuable for identifying novel immune cell subsets affected by Trim59
Can map Trim59 expression in tissue microenvironments (e.g., tumor-associated macrophages versus tissue-resident macrophages)
Provides context for understanding how Trim59 functions in complex tissue environments
Allows assessment of Trim59 protein levels alongside other signaling proteins
Can detect post-translational modifications and protein interactions at single-cell resolution
These technologies would be particularly valuable for studying Trim59 in complex disease models like cancer, where immune cell heterogeneity plays a crucial role in disease progression and therapy response.