Recombinant Mouse Tryptase gamma (Tpsg1)

Shipped with Ice Packs
In Stock

Product Specs

Form
Lyophilized powder.
Note: While we prioritize shipping the format currently in stock, please specify your format preference during order placement for fulfillment.
Lead Time
Delivery times vary depending on the purchasing method and location. Please contact your local distributor for precise delivery estimates.
Note: All proteins are shipped with standard blue ice packs. Dry ice shipping requires prior arrangement and incurs additional charges.
Notes
Avoid repeated freeze-thaw cycles. Store working aliquots at 4°C for up to one week.
Reconstitution
Centrifuge the vial briefly before opening to collect the contents. Reconstitute the protein in sterile, deionized water to a concentration of 0.1-1.0 mg/mL. We recommend adding 5-50% glycerol (final concentration) and aliquoting for long-term storage at -20°C/-80°C. Our standard glycerol concentration is 50% and can serve as a guideline.
Shelf Life
Shelf life depends on several factors, including storage conditions, buffer composition, temperature, and the protein's inherent stability. Generally, liquid formulations have a 6-month shelf life at -20°C/-80°C, while lyophilized forms have a 12-month shelf life at -20°C/-80°C.
Storage Condition
Upon receipt, store at -20°C/-80°C. Aliquot to prevent repeated freeze-thaw cycles.
Tag Info
Tag type is determined during manufacturing.
The tag type is determined during the production process. If you require a specific tag, please inform us, and we will prioritize its development.
Synonyms
Tpsg1; Tmt; Tryptase gamma; Transmembrane tryptase
Buffer Before Lyophilization
Tris/PBS-based buffer, 6% Trehalose.
Datasheet
Please contact us to get it.
Expression Region
30-311
Protein Length
Full Length of Mature Protein
Species
Mus musculus (Mouse)
Target Names
Tpsg1
Target Protein Sequence
IVGGHAAPAGTWPWQASLRLHKVHVCGGSLLSPEWVLTAAHCFSGSVNSSDYQVHLGELT VTLSPHFSTVKRIIMYTGSPGPPGSSGDIALVQLSSPVALSSQVQPVCLPEASADFYPGM QCWVTGWGYTGEGEPLKPPYNLQEAKVSVVDVKTCSQAYNSPNGSLIQPDMLCARGPGDA CQDDSGGPLVCQVAGTWQQAGVVSWGEGCGRPDRPGVYARVTAYVNWIHHHIPEAGGSGM QGLPWAPLLAALFWPSLFLLLVSGVLMAKYWLSSPSHAASEL
Uniprot No.

Target Background

Database Links
Protein Families
Peptidase S1 family, Tryptase subfamily
Subcellular Location
Membrane; Single-pass membrane protein.
Tissue Specificity
Expressed in many tissues.

Q&A

What is Mouse Tryptase gamma-1 (Tpsg1) and how does it differ from other mast cell proteases?

Mouse Tryptase gamma-1, also known as transmembrane tryptase, is a serine protease synthesized as a preproenzyme with a C-terminal transmembrane anchor. Unlike soluble tryptases, Tpsg1 contains a transmembrane domain that anchors it to the cell membrane. It belongs to a family of neutral serine proteases expressed by mast cells, which also includes other tryptases, chymase, and cathepsin G. Mouse Tpsg1 is encoded by the Tpsg1 gene, and the recombinant form is typically expressed as a soluble protein lacking the transmembrane domain (residues His20-Ala275) . This truncated form corresponds to the proenzyme that requires activation by trypsin to form the catalytically active enzyme.

What are the structural features of recombinant Mouse Tpsg1?

Recombinant Mouse Tpsg1 is typically produced as a soluble form spanning residues His20-Ala275 with a C-terminal 10-His tag to facilitate purification . The protein lacks the native transmembrane domain found in the cellular form. The molecular characterization of Mouse Tpsg1 includes:

ParameterSpecification
Amino acid sequenceHis20-Ala275, with C-terminal 10-His tag
Accession numberQ9QUL7
Expression systemE. coli (typically)
FormulationSupplied as 0.2 μm filtered solution in Tris, NaCl, and CaCl₂
Specific activity>100 pmol/min/μg (after trypsin activation)

The protein exists as a proenzyme that requires proteolytic cleavage by trypsin to become enzymatically active, reflecting its natural activation process in vivo .

How should recombinant Mouse Tpsg1 be activated for functional studies?

Proper activation of recombinant Mouse Tpsg1 is critical for functional studies. The activation protocol involves:

  • Dilute rmTPSG1 to 200 μg/mL in Activation Buffer (50 mM Tris, 10 mM CaCl₂, 150 mM NaCl, 0.05% w/v Brij-35, pH 7.5)

  • Dilute Trypsin to 0.164 μg/mL in the same Activation Buffer

  • Combine equal volumes of the diluted rmTPSG1 and trypsin solutions

  • Incubate at 37°C for 30 minutes

  • To terminate trypsin activity, add rhSerpin F2 (α₂-Antiplasmin) diluted to 3.62 μg/mL in Assay Buffer (50 mM Tris, pH 8.5)

  • Incubate for 15 minutes at room temperature

This activation step is essential because recombinant Tpsg1 is produced as a proenzyme lacking catalytic activity. The trypsin treatment cleaves the protein at specific sites to generate the active form with enzymatic capabilities.

What is the recommended assay for measuring Mouse Tpsg1 enzymatic activity?

The enzymatic activity of Mouse Tpsg1 can be measured using fluorogenic peptide substrates. A standard protocol includes:

  • Prepare activated rmTPSG1 as described in section 2.1

  • Dilute activated rmTPSG1 to 2 ng/μL in Assay Buffer (50 mM Tris, pH 8.5)

  • Dilute fluorogenic peptide substrate (MCA-Arg-Pro-Lys-Pro-Val-Glu-NVAL-Trp-Arg-Lys(Dnp)-NH₂) to 20 μM in Assay Buffer

  • Load 50 μL of diluted rmTPSG1 into plate wells

  • Add 50 μL of substrate solution to initiate the reaction

  • Include a substrate blank (50 μL Assay Buffer + 50 μL substrate)

  • Measure fluorescence at excitation 320 nm and emission 405 nm in kinetic mode for 5 minutes

  • Calculate specific activity using the formula:
    Specific Activity (pmol/min/μg) = [Adjusted Vmax (RFU/min) × Conversion Factor (pmol/RFU)] ÷ enzyme amount (μg)

This assay provides quantitative measurement of rmTPSG1 proteolytic activity, which is essential for functional characterization studies.

What role does Tpsg1 play in inflammation models?

Mouse models with inactivated γ-tryptase gene (Tpsg1) have demonstrated resistance to the development of inflammation in colitis models and cigarette-induced inflammatory conditions . This suggests that Tpsg1 plays a significant role in promoting inflammatory processes. The mechanisms may involve:

  • Proteolytic activation of pro-inflammatory mediators

  • Degradation of anti-inflammatory factors

  • Modulation of immune cell recruitment and activation

  • Alteration of vascular permeability

Researchers investigating inflammatory conditions should consider Tpsg1 as a potential mediator and therapeutic target. The phenotypic changes observed in Tpsg1-deficient mice provide valuable insight into the physiological and pathological functions of this protease.

How can inhibition studies of Mouse Tpsg1 be designed and interpreted?

When designing inhibition studies for Mouse Tpsg1:

  • Use recombinant ecotin (a serine protease inhibitor) as a positive control inhibitor. Typically, >95% of Tpsg1 protease activity is inhibited by ecotin at approximately a 10:1 molar ratio

  • Include appropriate controls to distinguish between inhibition of Tpsg1 activation and inhibition of already activated Tpsg1

  • Perform concentration-response studies to determine IC₅₀ values for potential inhibitors

  • Consider both competitive and non-competitive inhibition mechanisms

  • Evaluate the specificity of inhibitors by testing against other serine proteases

Interpretation should account for:

  • The activation state of Tpsg1 (pro-enzyme vs. activated form)

  • Potential off-target effects on trypsin if using the trypsin activation method

  • Physiological relevance of inhibition concentrations

What are important considerations when comparing mouse and human Tpsg1 in translational research?

When conducting translational research involving Tpsg1, researchers should consider these key differences between mouse and human forms:

ParameterMouse Tpsg1Human Tpsg1
Amino acid sequenceHis20-Ala275Arg20-Arg281
Specific activity>100 pmol/min/μg>70 pmol/min/μg
Activation conditionsTrypsin treatment, 30 min at 37°CTrypsin treatment, 2 hours at 37°C
Optimal assay pHpH 8.5pH 8.0

Additionally, there may be species-specific differences in:

  • Substrate specificity profiles

  • Sensitivity to various inhibitors

  • Expression patterns in different tissue types

  • Functional roles in disease models

These differences must be carefully considered when extrapolating findings from mouse studies to human applications or when selecting the appropriate species for specific research questions .

What factors affect the stability and activity of recombinant Mouse Tpsg1?

Several factors can impact the stability and activity of recombinant Mouse Tpsg1:

  • Storage conditions: Use a manual defrost freezer and avoid repeated freeze-thaw cycles to maintain protein integrity

  • Buffer composition: The presence of calcium (CaCl₂) is critical for maintaining proper protein folding and activity

  • Activation efficiency: Incomplete activation by trypsin can result in reduced enzymatic activity

  • Inhibitors and contaminants: Endogenous inhibitors or contaminants in experimental buffers can affect activity measurements

  • Protein concentration: Dilution below recommended concentrations can lead to activity loss due to protein adsorption to surfaces

For optimal results, store the protein according to manufacturer recommendations and prepare fresh dilutions immediately before use in assays.

How can I verify that my recombinant Mouse Tpsg1 has been properly activated?

To confirm proper activation of Mouse Tpsg1:

  • Control experiments: Include both non-activated and activated samples in parallel. Only the activated sample should show significant enzymatic activity

  • Time-course analysis: Monitor the activation process over time by taking aliquots at different time points and measuring activity

  • SDS-PAGE analysis: Activated Tpsg1 shows a characteristic shift in molecular weight due to proteolytic processing

  • Activity comparison: Compare your sample's specific activity to the expected value (>100 pmol/min/μg). Significantly lower values may indicate incomplete activation

  • Inhibitor sensitivity: Fully activated Tpsg1 should be inhibited by specific inhibitors like ecotin at expected ratios

Proper activation is crucial for reliable experimental results, as the non-activated proenzyme has minimal to no enzymatic activity.

How is Mouse Tpsg1 being used to study mast cell functions in disease models?

Current research applications of Mouse Tpsg1 include:

  • Inflammatory bowel disease models: Tpsg1-deficient mice show resistance to colitis development, suggesting a role in intestinal inflammation pathways

  • Airway inflammation models: Studies investigating cigarette smoke-induced inflammation use Tpsg1 as a marker and potential mediator

  • Mast cell activation assays: Tpsg1 activity serves as a biomarker for mast cell activation in various experimental settings

  • Protease-activated receptor research: Investigating the role of Tpsg1 in activating PARs and subsequent cellular signaling

  • Pharmacological inhibition studies: Screening potential therapeutic compounds targeting mast cell proteases

These applications leverage the unique properties of Tpsg1 to understand mast cell biology and develop potential therapeutic approaches for inflammatory conditions.

What novel methodologies are being developed for studying Mouse Tpsg1 functions?

Emerging methodologies for Tpsg1 research include:

  • CRISPR/Cas9 gene editing: Creating precise Tpsg1 modifications to study structure-function relationships

  • Conditional knockout models: Tissue-specific or inducible Tpsg1 deletion to avoid developmental compensation

  • Intravital imaging: Visualizing Tpsg1 activity in live animals using specialized substrate-based probes

  • Proteomic approaches: Identifying natural substrates and interacting partners of Tpsg1 in physiological contexts

  • Systems biology integration: Placing Tpsg1 activity within broader networks of inflammatory and immune signaling

These advanced approaches are helping researchers to better understand the context-specific functions of Tpsg1 and its potential as a therapeutic target.

Quick Inquiry

Personal Email Detected
Please use an institutional or corporate email address for inquiries. Personal email accounts ( such as Gmail, Yahoo, and Outlook) are not accepted. *
© Copyright 2025 TheBiotek. All Rights Reserved.